KEGG   Metarhizium acridum: MAC_00220Help
Entry
MAC_00220         CDS       T03104                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
maw  Metarhizium acridum
Pathway
maw00052  Galactose metabolism
maw00500  Starch and sucrose metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MAC_00220
   00500 Starch and sucrose metabolism
    MAC_00220
Enzymes [BR:maw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MAC_00220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975 DUF4185 DUF1249
Motif
Other DBs
NCBI-GeneID: 19244531
NCBI-ProteinID: XP_007806560
UniProt: E9DR51
Position
Unknown
AA seq 571 aa AA seqDB search
MAYSRYRPTSHFIAPHSWSNDPCGAVYIPESREYLVCYQWNPGTTEGGNCAWGMAKSKDL
VTWEDCKPAIWNGTSYDSLGVFSGSIVSRLAAGKRVLYLYYTSVSALPIHWSQPYIKGCE
TQSVAISTDLGQTWVRHRNNPLLTVPPKEGATTGWRDPFVTQSQSLSKLLGLSRDTNYMM
LSSGERKRGPQLHLYKSRSLSSSSWEYVSTVLDVGLHDYISKRSNSRWGINFECASFFNM
GETDYMIVGVEETEESKRHNGHSLLWMSGKFVLNEHNLPIFDIRGHGMLDHGVLYAAHIF
KDAENRLIQLGWADETAKKQLVQGQGWAGCLGHPREIAEISRPLVHDVESWPEWHIDHSS
GVMKTLGIRPAPQVDTLRQGLPDYSSLEDLKTLRSKSYELKMTFSHLCGLEKFVLDVLQS
PGCTEVTRLIFDLEQQQMVVDRSRSSLQQLSATAPDSGDLRLLPGEDLQVRIFVDVSIVE
IFVNDRFALTSRVYPSMETSTAAAYDLNGFDEGNVKFECWQGLKNAWPARGSGCGLLPEL
HPLYQKAENKKMDKDSFATRSEMPLEMAAVS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggcatactcgcgataccgaccaacttcccacttcatcgcaccacactcatggtccaat
gacccctgcggcgcagtgtacatcccagaatcacgggaatacctcgtctgttaccaatgg
aacccgggcaccactgaaggaggcaactgcgcctggggcatggcaaagagcaaagacctc
gttacctgggaggattgcaagcccgccatttggaacggcacctcatacgattccctgggc
gtattttccggatcgattgtttcaagattagctgcgggcaaaagagtcttatacctgtat
tacaccagcgtatctgccctgccaatccactggtctcagccgtacatcaagggatgcgaa
acacagtcagtcgccatctccacagacttgggtcagacttgggtcaggcaccggaataat
ccgttgctgacagtccctcccaaagagggcgcaaccacaggatggcgcgatccgttcgtt
acccaatcacaatcgctgtcaaaactgcttggtctgagtcgagacacgaattacatgatg
ctttcctcgggcgagcggaaacgcggtcctcagctccatctatacaagtctcgcagcctt
tcatccagttcatgggaatacgtttcgaccgttttggatgttgggctgcacgattacatc
tccaaacgaagcaactcaaggtggggtatcaacttcgaatgtgccagtttcttcaacatg
ggtgaaacggactacatgatagttggcgttgaggagacagaagagagcaaacgccataat
ggccactctctgctctggatgtccggcaagtttgtgttaaatgagcacaacctgcccata
tttgatattcgcggccacggcatgctcgatcatggcgttttgtacgccgcgcatattttc
aaagatgcagagaaccgcctgatacagctgggatgggcggacgagactgcaaagaaacag
ctggttcagggacaaggctgggccggctgcctaggccatccgcgagagattgcggaaatt
tcacgaccgctcgtccacgacgtcgagtcatggccagaatggcacattgaccactcgtct
ggggtcatgaaaacgctgggaattcggccagcgccgcaggttgataccctccgacagggg
cttccagactattcttctcttgaagacctcaaaacccttcggtcgaagagctacgagttg
aaaatgacgttttctcatttgtgtggtttggaaaagtttgtccttgacgtgctccaatcg
cctggctgcaccgaggtgacaaggctcattttcgaccttgaacaacagcagatggttgta
gaccgatcaaggtcgtcactacaacagttgagcgccactgcgcctgactcgggcgacctc
aggctcctgccaggggaagatcttcaagttaggatcttcgtcgatgtgtctattgtcgaa
atttttgtcaatgataggtttgcgctcacttcacgggtgtatccgtcaatggagacttct
acagccgccgcgtacgacttgaatgggtttgacgagggaaacgtcaagtttgagtgctgg
caaggattgaagaacgcttggccggcaaggggttccggctgtggcctattaccggagcta
caccctttgtatcagaaggcagagaataaaaaaatggacaaggacagtttcgctacccgt
agcgaaatgcctctggaaatggccgcagtttcgtga

DBGET integrated database retrieval system