KEGG   Metarhizium acridum: MAC_01655Help
Entry
MAC_01655         CDS       T03104                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
maw  Metarhizium acridum
Brite
KEGG Orthology (KO) [BR:maw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MAC_01655
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     MAC_01655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DUF1664 EcoR124_C Halogen_Hydrol Harakiri XhlA
Motif
Other DBs
NCBI-GeneID: 19245966
NCBI-ProteinID: XP_007807995
UniProt: E9DVK7
Position
Unknown
AA seq 567 aa AA seqDB search
MPSAPRALAAFGRASQLALPARVGSRAYSTAYSTATGRHALRSAARPTVAMRLAATGRVA
FRRAYADEAPKPKPGRLRRTFRWAWRLTYLSAVGLVGYTCYIVYQDRHPEPQFEPDPTKK
TLVILGTGWGSVALLKKLDTENYNVVVVSPRNYFLFTPLLPSCTTGTIEHRSIMEPVRTI
LRHKKAAVKFYEAEASSIDPDRKVVKIVDNSEIQGATSETEIPYDMLVIGVGAENATFGI
PGVRENSCFLKEIGDAQQIRKKIMDCVETAAFKGQTSDEIDRLMHMVVVGGGPTGVEFAG
ELQDFFEEDIKKLVPEISPRFKVTLIEALPNVLPSFSKQLIDYTENTLREEKIDIKTKTM
VKRVTNTTVEAEVSRPDGGKERVVIPYGLLVWATGNAVRPIIKDLITKIPAQKDSRRGLA
VNEYLVVQGTRDIWAIGDCAVAGYAPTAQVASQEGNFLGRLFNNMAKTEKHESRIQELSS
KMNLQAGNSAEAAQEIESLEKQLRRIKDIKPFRYSHQGSLAYIGSEKAVADVSWWNGNLA
TGGRMTYLFWRSAYLSMCFSSESYPFL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgccccccgagctctggccgccttcggtcgagcaagtcaattggcactgcca
gcccgcgtcggatccagagcgtactctacagcctactctacggcaaccggacgtcatgct
ctgcgatcagctgcgaggccgaccgtcgccatgaggctcgccgcgaccggcagggtcgca
ttccgcagagcttatgctgacgaagcccccaagcccaagcccggcagactgcgcagaacc
ttcagatgggcatggagactcacctacctctccgccgttggccttgtaggctacacttgc
tacatcgtctaccaggatcgccatcccgaaccgcagttcgagccggatccaaccaagaag
acgctcgtcattctaggtactggctgggggtctgtcgccttgctcaagaagttggatacg
gagaattacaacgtcgtcgtcgtctctccccggaactatttcttgttcactcccctcctg
ccgtcatgcacgaccggcaccatcgagcacaggtccattatggagcctgttcgaaccatt
ctacgacacaagaaagcagcagtcaagttttatgaggcggaagcctcatcaatcgacccc
gatcgaaaggtcgtcaagattgtcgacaactcggaaatccagggggccacctccgagacc
gagattccttacgacatgctcgttattggcgtcggtgctgagaacgcaacctttggcatt
cccggtgtgcgagaaaatagctgtttcctcaaggagattggcgatgcccagcagatccgc
aagaagatcatggactgcgtcgagacggccgccttcaagggacagaccagcgacgagatt
gacaggctgatgcacatggttgttgtcggcggcgggcccactggcgttgagtttgctggc
gagctccaggacttcttcgaggaggacatcaagaagctcgttcctgaaatcagccctcgc
ttcaaggtcaccctgatcgaagccctccctaatgtccttccctccttctcaaagcagctc
attgattacaccgagaatacgctccgtgaggaaaagattgacatcaagacaaagaccatg
gtcaagagggtcacgaataccacagtcgaggccgaggtcagtcgccctgacggtggcaag
gagcgcgttgtcattccttacggccttctggtatgggccaccggcaacgccgttcggcca
atcatcaaggacctgataaccaagattcctgcccagaaagattcccgccgtggcttggcc
gtcaacgagtacctggttgtgcagggtacccgtgatatctgggctattggtgactgcgcc
gtcgctgggtatgctcccactgcacaggtggcgtctcaggaaggcaacttcctcggccgg
ctgttcaataacatggccaagactgaaaagcacgagtcccgcattcaggagctgagcagc
aagatgaatctgcaggccggtaactcggccgaggccgcacaggagattgagagcctggag
aagcaactgcgcagaattaaggatattaaacccttcagatacagtcaccagggcagcttg
gcttacattggtagtgagaaggccgttgctgatgtcagttggtggaacggaaatttggcc
accggtggcagaatgacctatcttttctggcgcagcgcttacctctccatgtgctttagc
agtgagtcataccccttcctttga

DBGET integrated database retrieval system