KEGG   Metarhizium acridum: MAC_02492Help
Entry
MAC_02492         CDS       T03104                                 

Definition
(RefSeq) succinate-CoA ligase (alpha subunit)
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
maw  Metarhizium acridum
Pathway
maw00020  Citrate cycle (TCA cycle)
maw00640  Propanoate metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
maw01130  Biosynthesis of antibiotics
maw01200  Carbon metabolism
Module
maw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAC_02492
   00640 Propanoate metabolism
    MAC_02492
Enzymes [BR:maw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     MAC_02492
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MAC_02492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 19246803
NCBI-ProteinID: XP_007808832
UniProt: E9DXZ4
Position
Unknown
AA seq 290 aa AA seqDB search
MPTRASFTKASLKEATSNAKDTIGYGTKVVGGVSPGKGGRTHLDLPVFGTVKEAVEQVKP
HVSAVFVPAQFAAKAIIEAIEAEVPVVVSVAEHIPVHDLLRVQEVLRTQSRSRLVGPNCP
GIIAPDQCRVGIMPFRQYTRGCVGIVSKSGTLSYEAVGATSAAGLGQSFVIAVGGDPMPG
TTIVDSLRVFFDHEETEGIIVIGEIGGEQELRAAEMIRAYRRSTPNPKPIVAMVAGQTAP
RGKVMGHAGAVLTARDVTAAEKARALEDAGAVVVPHPGVMGSTMKALLGR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgccaacacgcgcatcatttaccaaggcgagtctcaaggaagccacttccaacgccaaa
gacacaattggctacggcacaaaagtcgtcggcggcgtctcgcccggcaaaggcggcagg
acgcacctcgacctcccagtctttggaaccgtcaaagaggccgtggagcaggtcaaaccc
catgttagcgcagtctttgtgcccgcccagttcgcggccaaggccatcatcgaagcaatc
gaggccgaggtgcccgtcgtcgtctccgtcgccgagcacatccccgttcacgacctcctc
cgcgtgcaggaggtgcttcgcacgcagagcaggtcgcgcctcgtagggcccaactgcccc
ggcatcatcgccccggaccagtgccgcgtgggaatcatgccctttcggcagtacactcgg
ggctgcgtgggcatcgtgtccaagtccggcaccctgagctacgaggctgttggcgcgacg
agcgcggccggcctgggacagagttttgtcattgccgtaggcggcgatcccatgccaggc
acgaccatcgtcgattctctcagggtcttctttgaccatgaggaaacagagggcattatc
gtcattggcgagattggcggcgagcaagagctccgcgcggccgagatgatcagggcgtat
aggaggtcgacgccgaaccccaagccgattgtggccatggtggcgggacagacggcgccg
aggggcaaggtcatgggccatgcgggtgctgttttgacggcgagggatgtcacggctgcc
gagaaggcgagggctttggaggatgcgggtgcggttgttgtgcctcatcctggcgtcatg
ggctctacaatgaaggcccttcttgggcggtga

DBGET integrated database retrieval system