KEGG   Metarhizium acridum: MAC_02665Help
Entry
MAC_02665         CDS       T03104                                 

Definition
(RefSeq) hypothetical protein
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
maw  Metarhizium acridum
Pathway
maw00760  Nicotinate and nicotinamide metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MAC_02665
Enzymes [BR:maw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     MAC_02665
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     MAC_02665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 19246976
NCBI-ProteinID: XP_007809005
UniProt: E9DYG8
Position
Unknown
AA seq 278 aa AA seqDB search
MASDFPYVKKMTPKEGYVFPSHRLQRTCDAGRVPLVLVACGSFIGGYLSPVSDAYKKKGL
APAHHRIRMCEIAAENTSKWLMVDPWEAVSPTYIPTARVLDHFDYEINHVMGGVECSDGT
RKPAKIVLLAGADLIQTISTPDIWDAQDVDHILGNFGVFVLERTGTELDSALAALKPWEK
NIHVIRQVVTNDISSTKVRLLLKRDMSIDYLIPDNVINYIYEHNLYRELDLAAGSKGKEK
ADGRFVLNPTLRGVPSQLRTEADIGRSRFFSPCFVVVP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgacttcccctacgtcaaaaagatgactcccaaggagggctacgtcttccct
tcccaccggctacagcgcacatgcgacgccggtcgagtgcccctcgtcctggtagcttgc
gggtcctttattggaggctacctctcccccgtgtccgacgcctataagaagaagggtcta
gcacccgcacatcaccgaattcgaatgtgcgaaatcgccgccgaaaatacctccaaatgg
ctcatggttgatccctgggaggccgtgagtccgacttatattcccactgcccgcgtcttg
gatcatttcgactacgagatcaatcatgtcatgggaggcgttgagtgctctgacggcact
cgtaagccagccaaaatcgtcttgctggccggcgccgatttaatccagaccattagcacc
ccggacatctgggatgcccaggatgtggaccatattctgggtaactttggcgtctttgtc
ctggaacgaacagggaccgaacttgactcggctctggcggctctgaagccttgggagaag
aatatccacgtcattcgacaggttgtgacaaacgacatttcaagtacaaaagtccgactt
ttactgaagcgagatatgagtatcgattatttaattccggacaatgtcattaattatatt
tacgaacataatctgtatcgcgagctggaccttgccgctggcagcaaggggaaggagaag
gcagatgggcgttttgtcttgaatcctactttgcgtggtgtgcccagtcagttacgaact
gaggcggatattgggaggagtcgttttttctctccttgttttgttgttgtgccgtga

DBGET integrated database retrieval system