KEGG   Metarhizium acridum: MAC_02912Help
Entry
MAC_02912         CDS       T03104                                 

Definition
(RefSeq) nitrilase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
maw  Metarhizium acridum
Brite
KEGG Orthology (KO) [BR:maw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MAC_02912
Enzymes [BR:maw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     MAC_02912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 19247223
NCBI-ProteinID: XP_007809252
UniProt: E9DZ64
Position
Unknown
AA seq 338 aa AA seqDB search
MGMVFVSGSIWGCDTQSGGLVDLHVGFGPDLTSTNPSTTLGLRSDHDAKPKFTMAIAAVG
QICSTASVKANLDQCVRLVSKAAVGGAKVLFLPEASDYLAHNAQESLALAQPQSTSPFVQ
GLCAAAKSHSVAVHVGVHEPLPGRPTSKLLNRALYISPAGDVVDAASYDKLHVFDYANLR
ESDSVQPGSSLTAPFDSPVGRIGSLICFDVRFAEPALALAQPGPGSPWSRRPAQVLTYPS
AFTLRTGRAHWEALLRGRAIEAQSWVVAAAQVGRHNDKRASYGRSLIVDPWGEVRLRLGG
TRNDEGEAEDGAVEEIGFVDLDLALWETVRREMPLKRR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggggatggtctttgtaagcggcagcatctggggctgtgacactcaatcaggtgggttg
gtggatctgcatgtcggatttggaccagacctcacctcaaccaacccatcaaccacactc
ggcttgcgcagcgaccacgacgcaaagcccaagttcaccatggcgattgcagcagtcggg
cagatctgttccacggcgtcggtgaaagccaatctcgaccagtgtgtgagactggtttcc
aaagcagccgtcggcggagcaaaggtcctcttcctccccgaggcatcagactacctggcg
cacaatgcacaagagtccctcgccctcgcgcaaccgcagtccacgtctccgtttgtccag
ggcctctgcgccgccgccaagtcgcactcggtggccgtccacgtcggcgtccacgaaccg
ctcccggggcggcccacgtccaagctgctcaaccgcgccctctacatctcgcccgcgggg
gacgtggtcgacgcggcgtcgtacgacaagctccacgtctttgactacgccaacctcagg
gaaagcgactcggtgcagccaggatccagcctcacggccccgtttgactcgcccgtgggc
cgcatcggcagcctcatctgctttgatgtgcgattcgccgagccggccctcgccctggcg
cagccggggcccgggagcccgtggtcccggcggccggcgcaggtcctcacgtatcccagc
gcctttacgctgcgcacgggacgggcacactgggaggcgctgctgcgcggcagggccatc
gaggcgcagagttgggttgtggccgcggcccaggttgggagacacaacgacaagagggcc
agctacggacgcagtttgatcgttgacccgtggggggaggtcaggctaaggctgggaggg
acccggaacgacgagggcgaggccgaggacggcgccgtcgaggagattggctttgtggat
ttggatctggcgctttgggagacggttcggcgggagatgccgctgaagaggaggtga

DBGET integrated database retrieval system