KEGG   Metarhizium acridum: MAC_06614Help
Entry
MAC_06614         CDS       T03104                                 

Definition
(RefSeq) urea active transporter, putative
  KO
K20989  urea-proton symporter
Organism
maw  Metarhizium acridum
Brite
KEGG Orthology (KO) [BR:maw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maw02000]
    MAC_06614
Transporters [BR:maw02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   MAC_06614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 19250925
NCBI-ProteinID: XP_007812954
UniProt: E9E9R6
Position
Unknown
AA seq 622 aa AA seqDB search
MASVIAAAPLSRPYHNLLEMFMTANRRVGTGLTASAVISSWLWSTAMLGSTLVGYNFGVA
GPFWFAAGCSPMIVFFSLLGIACKLRVPEAHTLLEIVRIRYGTQGHVVWIVLCLINNIIA
VANMLLGASAAISALTGMHIIAATFLLPVGVVLYTFVGGIKATFLTDYFHTFVITVIVCF
FTIKVFLVPEIGSPQDLFDIIAKAGQIHPVDGNRDGSYLTMTSKGAILFGIIHILANFGL
VIMDTGFFAKAFSAAPHAVVPGYIVGGIAYFAIPWCLGTIMSFAALSLEGTERFPTFPRR
LSPTEVSNGLVLPYAAVAIAGKGGAVAVVLITFMAVTSTISAQVISVSSIISFDIYRQYF
NKDARDSDAIRWTHIGVVAFGIFSAAFSTALHYGNVDLGWTLYMLGVLTCPGIIPTVFTI
LWKRQSKLAAVSSPILGMATGIGVWLGSAAALYGEISVATTGQTLPCVYGTVASAFSPAL
YSVVVTIIRPDNFDWAFFRNERLAFNTSSASVAEASESDKKEPKTHDEYIQSYAADKAKL
KRWGTIAAVWSLATFLGHWVLWPLPMYAANYVFSQSFFVAWVLVSIVWVWGTMLVAGFYP
IIDGWGQLSQVYRGLRQGRLRG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggtgatagcggcagcaccgttgagccgcccttaccacaatctgctggaaatg
ttcatgacggccaatcggagagttggcacaggactaacagcatcagctgtaatttcgtct
tggctatggagtaccgcgatgcttgggagcactcttgtgggctacaactttggcgtcgcc
ggtccattttggtttgccgcaggctgctcaccaatgattgtattcttctccttgctcggc
atcgcctgcaagctccgagttccggaagctcatacattgttagaaattgtcagaatcaga
tatggcacacagggtcatgtggtctggattgtgctgtgcttgatcaacaacatcatcgct
gtagcaaatatgcttcttggcgccagtgccgccatttccgctcttaccggaatgcatatt
attgctgctacgtttctattgcccgttggggttgtgttatacacctttgttggaggcatc
aaggcaacctttttaaccgattatttccacacgtttgtcatcacagtaattgtttgtttc
ttcacaatcaaggtatttttggtgcctgagattgggagtccacaagatctgttcgatatc
atcgccaaggctggccaaatccatcccgttgacggtaatcgagacggttcatatcttacc
atgacaagcaaaggggctattctatttggtataatccatatcctggccaactttgggctt
gtcatcatggacacgggcttctttgcaaaggcatttagtgctgcgcctcacgccgtggta
cctgggtacatcgtcggtggaatcgcatactttgccatcccgtggtgtctcgggaccatc
atgagtttcgcagcactgagcttggagggcacagagcgttttccaacgttccctcgacgc
ttgtcacctacagaagtctccaacggcctagttcttccgtatgccgccgtcgctatcgct
ggcaagggtggtgccgttgcagtggtgttgattaccttcatggcggttacatcaacaatc
agtgcccaagttatctcagtgtcctccatcatcagtttcgacatatatcggcaatacttc
aataaagatgccagagacagcgatgccatccgatggactcatataggcgttgttgcgttt
ggcatcttctcggcggctttctcgacagcactgcattatggcaatgtggatcttggctgg
actctttacatgcttggtgtattgacctgccccggcatcatcccaactgtattcacaatt
ctgtggaaacgtcaatccaagctggctgctgtaagttcgccaatattaggaatggcaact
ggcatcggcgtgtggctaggttcagcggcagccctttacggagaaatcagtgtcgccaca
acagggcagacgttaccttgcgtctatggaacagtcgcctctgccttcagtccagccttg
tactcggtcgttgttacaatcataaggccagacaattttgattgggctttctttcggaac
gaaagactggcctttaatacctcatctgcaagtgtagctgaggcatcagagtcggacaaa
aaagaaccgaagacacacgatgaatacattcagagctatgccgccgacaaggccaagctg
aaacgttggggaaccattgcagcagtctggagcttagcaacatttctaggacactgggtt
ctctggcctttgccaatgtatgcggcaaactacgtttttagccagtcgttctttgtagca
tgggtacttgtatcaatcgtttgggtctgggggaccatgctcgttgccggcttttacccc
attattgatggctggggacaattgagccaagtctaccgtggacttcgccaagggcggctc
agaggctga

DBGET integrated database retrieval system