KEGG   Metarhizium acridum: MAC_06783Help
Entry
MAC_06783         CDS       T03104                                 

Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
maw  Metarhizium acridum
Pathway
maw00564  Glycerophospholipid metabolism
maw00565  Ether lipid metabolism
maw00590  Arachidonic acid metabolism
maw00591  Linoleic acid metabolism
maw00592  alpha-Linolenic acid metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MAC_06783
   00565 Ether lipid metabolism
    MAC_06783
   00590 Arachidonic acid metabolism
    MAC_06783
   00591 Linoleic acid metabolism
    MAC_06783
   00592 alpha-Linolenic acid metabolism
    MAC_06783
Enzymes [BR:maw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     MAC_06783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 19251094
NCBI-ProteinID: XP_007813123
UniProt: E9EA85
Position
Unknown
AA seq 800 aa AA seqDB search
MKRLGNLTKGLPALNPSLRAGSRPVGPSLHKKFQHGFSTVSKRTTAIGASLPATIVAGTL
FIWWLYPTDEFAKLSPPRPRRRRHYYDDEEVDEQEDQDEDEYDDQPETAWDSFARRIENI
AIVTETEWSAFSERVADMIIPDWSKLVPGYLRKLQRELSMAPGSLADEIWEDAHDPAINP
EIAYTAQVRVSSQLCDDEKEFLARRKRVIKVALAKYLGLDEHEIHPDDIPTIAMCGSGGG
LRALVAGTGSLIAADEDGLFDCVTYTAGVSGSCWLQTLLNSSITGGNFKKLLEHLKNRTS
VHIAYPPVAFQSLVSMPTSKYLLSGLVEKLRGDSKADFGLVDVYGLLLGARFLVPKGELG
VNEKDFKLSNQRDAIKFGDRPLPIYTVVRHEIPQTEKTNRGPTEREKKIAKEESWFQWYE
ITPYEFFCEEFGAGIPTWAMGRKFNNGKDVPSENRFHLPEIRVPLLMGIFGSAFCATLSH
YYKEIKPLVLSISGLSGVDQFVSGRDNDLSKVHPIEPASIPNFAYQMHGKLPDTTPKSIY
EQEHIQLMDAGMSNNLPIYPLLRPGRDVDILIAFDASADIKTDNWLSVADGYARQRGIKG
WPLGIGWPKAGESVEETTMQLVEAEASSSQEAARRVKQAKQDQESLRQTAGSIAEDPQAD
DREAKYSPGNEEAGDLGYCTVWVGTTQERSPHPPPPAKAINDTNKWQLTEPDAGLAVVYV
PFLANKKGPDISPGTTDFLSTWNFVYTPNQIDSVVDLARANYNEGRNQIRSTVRAVYERK
KLLRERAEKKRVQGLEILST
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggctcggcaacctcaccaagggtttgccggctctcaacccgtcactgagagct
ggttcccgccctgtcggtccatcattgcacaagaaatttcagcatggtttctctactgtg
tcgaaaaggaccaccgctattggtgcaagcttacctgccaccattgtagctggaacttta
tttatctggtggctctatccgacagatgaatttgcaaagctgtctcctccacgtccaagg
aggagacggcactattacgatgatgaagaggtggatgaacaggaagaccaggacgaagat
gagtatgacgaccagcctgagacggcctgggacagcttcgcgaggcgcatcgaaaacatc
gccatcgtcaccgagacagaatggtccgccttctccgaaagagttgcggacatgatcatt
ccagactggtcaaaactggtccccggatacttgcggaaacttcagagggagctttccatg
gccccagggtctcttgccgatgagatctgggaggacgcccacgatcccgccatcaatccc
gaaattgcatacacggctcaggttcgggtatcctcgcaattatgtgacgatgagaaagag
tttctagcgaggcggaaacgtgtcataaaagttgctctggccaagtacctcgggcttgat
gaacatgaaatccatcctgatgatatacccactattgccatgtgtggatcagggggtgga
ctgcgtgctcttgtggctggcactggctcactcattgctgctgatgaagacggtcttttt
gactgtgtcacttacacggccggtgtcagcggttcgtgttggctacaaaccttgctcaac
tcatccataaccggcggcaacttcaaaaagctcttggagcatttgaaaaacagaacatct
gttcatattgcctacccaccagtcgcctttcagtctctagtttcgatgcccaccagcaaa
tatctcttgagtggtctcgtggagaagcttaggggtgactccaaggccgactttggtctg
gtcgatgtttacggtttactactgggagcacgatttttggtacccaagggcgagctgggg
gtcaacgaaaaggacttcaagttatctaatcagcgcgacgccatcaaattcggggatcgc
ccactgcccatttacacggttgttcgacacgagattcctcaaactgaaaagacgaatcgt
gggccgacggaaagggaaaagaaaatagccaaggaagaatcatggttccaatggtatgaa
atcacgccctacgaattcttttgtgaagagtttggggctggcattcccacctgggccatg
ggacgcaagttcaacaacggcaaagacgtaccgtcggaaaatagattccacttgcctgaa
attcgagtgcctctgttaatgggtatttttgggagtgctttttgcgcaactctcagtcac
tactacaaggaaattaagcctctggtcctgagcatatctggattaagcggggttgaccag
tttgtgtctggccgtgataacgacctgagcaaagttcatcccattgaaccagccagcatc
cctaactttgcctaccaaatgcatggcaagctgccggacaccacaccgaagagtatatat
gagcaagagcacatccaactcatggatgctggcatgtctaacaacctgcccatctatcca
ctcctccgccccggccgagacgtcgacattctcatcgcatttgacgcctccgcggacata
aaaacagataactggctctccgtagcggatggttatgctcgtcaacgtggtattaaaggt
tggccgctaggcattggatggccaaaagctggcgaatcagtcgaagaaaccaccatgcaa
ctcgtcgaagcagaggcatcctcatctcaggaggcagcacggcgcgtcaaacaagctaag
caggatcaagagtcacttcgccagactgccggctccatcgcggaagatcctcaagctgac
gacagagaagctaaatacagccctggaaacgaggaagccggtgacttgggctactgcacc
gtctgggtcggtaccacgcaagaacggtctccgcatcctccgccgccggctaaagcaatt
aacgataccaataagtggcagctaacagaaccggatgccggtctagctgtagtatacgtc
ccctttctcgctaacaagaaggggcccgatatttctcctggaacaacagactttttgagc
acttggaactttgtatatacacctaatcaaatcgatagcgtggtggatctcgcgagagca
aattataacgagggaaggaatcaaatccggtctactgttcgggcagtctatgagcggaag
aagttgcttcgcgaacgcgccgagaagaaacgtgttcaaggactcgaaatcttgagtacc
tag

DBGET integrated database retrieval system