KEGG   Metarhizium acridum: MAC_06863Help
Entry
MAC_06863         CDS       T03104                                 

Definition
(RefSeq) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
maw  Metarhizium acridum
Pathway
maw00564  Glycerophospholipid metabolism
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Module
maw_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MAC_06863
Enzymes [BR:maw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     MAC_06863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase RnfC_N Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 19251174
NCBI-ProteinID: XP_007813203
UniProt: E9EAG5
Position
Unknown
AA seq 422 aa AA seqDB search
MADQHCTENELAPAVNHLLQHIEKDAELLHLFEKAFREIPVQFQETPDGFGHERIRDYRQ
LIQAIDRASKTAPVWMSMLQSDCVIGCPMNEALIWFMNTRTGSQILARDDINSYLETILK
EWGHFLSSRASASVVHTREGGWVSQQARDELLLAVNVAHNSAFQAESFEDAFICDPTHPS
YGFQSWNDFFTRQLRPHIRPVACPEDDGVIVNPCESQPFALVTDVPEQQQYSLKGTMYSF
RDMLDNDPIASGFAGGTVFQGWLSLFNYHRWHAPVAGTVTKVLQIPGTYFVADPANGFEK
LDSTNQPCPDRQAPDASQRLITSIATRTVIVLSAEDARLGLVGFVAIGMSDVSSCVATVK
VGDRVSKGQEIGSFHYGGSSYCLLFQSGISLCFSPLVDASLNSQSIITGRCIAINSELAR
VS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccaacattgcacagaaaacgaacttgcacctgcggttaaccatcttctacaa
cacatcgaaaaagatgccgagctgcttcatctgtttgaaaaggcctttcgggaaatccct
gtgcagttccaggagaccccagacgggttcggccacgagcggattcgcgattatcgccaa
ctgatccaggcaattgaccgggcgtccaagacggcaccagtatggatgtccatgttgcag
tcggactgcgtcattggctgtccgatgaatgaagcattgatctggttcatgaatacccga
acaggatcccaaatccttgctcgcgacgacatcaactcctatctcgaaacgattctgaag
gaatggggtcattttttatcctcacgagcatccgcctctgtcgttcatactcgggagggt
ggctgggtgtcccagcaggcccgcgacgagcttctgctcgccgtcaacgtcgcccataac
tcagcgttccaggcggaatcttttgaagacgcattcatctgcgacccgacccacccatca
tacggcttccaatcctggaatgatttctttactcgtcaacttcggccgcacatcagacca
gtggcatgcccggaagatgatggtgtcatcgtcaacccctgcgagtcgcagccgtttgct
ctcgtgacagacgtgccggagcagcagcagtattcgttgaaagggaccatgtattcattc
cgagacatgcttgacaatgatcccatagcatcaggatttgcgggcggtaccgtctttcag
ggatggctgtctcttttcaattatcatcgatggcatgcacctgttgccggcacagtcacc
aaagtcctacaaatcccgggaacttacttcgttgctgatcccgcaaatgggttcgaaaag
cttgactctacgaatcaaccatgtccggatcgacaagctcccgatgcatcccaaaggttg
ataacctccattgccacgcgcacagtaattgtgctcagcgccgaggatgccaggttaggc
ctcgtaggattcgtagccattggtatgtcggacgtgtcgagctgcgtggctacggtcaag
gtaggagaccgtgtatcaaagggccaggaaataggcagctttcactacggcggcagttcc
tactgtctactgtttcagtcgggtatatcgctgtgcttttccccactggtcgatgcttct
ctaaatagtcagtcgatcattactggacgctgcattgccattaatagcgagctggcaagg
gttagttga

DBGET integrated database retrieval system