KEGG   Metarhizium acridum: MAC_07411Help
Entry
MAC_07411         CDS       T03104                                 

Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
maw  Metarhizium acridum
Pathway
maw03040  Spliceosome
maw04141  Protein processing in endoplasmic reticulum
maw04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:maw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    MAC_07411
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MAC_07411
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MAC_07411
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:maw01009]
    MAC_07411
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:maw03041]
    MAC_07411
   03009 Ribosome biogenesis [BR:maw03009]
    MAC_07411
   03110 Chaperones and folding catalysts [BR:maw03110]
    MAC_07411
   04131 Membrane trafficking [BR:maw04131]
    MAC_07411
   03051 Proteasome [BR:maw03051]
    MAC_07411
   03029 Mitochondrial biogenesis [BR:maw03029]
    MAC_07411
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maw04147]
    MAC_07411
Protein phosphatases and associated proteins [BR:maw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     MAC_07411
Spliceosome [BR:maw03041]
 Complex B
  Other components
   Prp19 complex
    MAC_07411
 Complex C
   Prp19-CDC5 complex
    MAC_07411
Ribosome biogenesis [BR:maw03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    MAC_07411
Chaperones and folding catalysts [BR:maw03110]
 Heat shock proteins
  HSP70 / DNAK
   MAC_07411
Membrane trafficking [BR:maw04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    MAC_07411
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    MAC_07411
Proteasome [BR:maw03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    MAC_07411
Mitochondrial biogenesis [BR:maw03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    MAC_07411
Exosome [BR:maw04147]
 Exosomal proteins
  Proteins found in most exosomes
   MAC_07411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 19251722
NCBI-ProteinID: XP_007813751
UniProt: E9EC13
Position
Unknown
AA seq 614 aa AA seqDB search
MGDEVYDGAIGIDLGTTYSCVATYEGTNVEIIANEQGSFTTPSFVSFTDKERLIGDAAKN
NAAMNPKNTVFDAKRLIGRRYDDPTVKKDIESWPFTIIDDAGQPKIQVEYLGEKKEFSAQ
EISAMVLTKMKEIAETKLGKKVEKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEPT
AAAIAYGLGSGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDTN
LLEHCRTAFTRKTKKDLSGDARALRRLRTACERAKRTLSSGAQATIEIDSLFDGEDFTMT
ITRARFEELNAKAFAGTLEPVAQVLKDAAIEKSAVDEIVLVGGSTRIPKIQKLLSEFFDG
KKLEKSINPDEAVAYGAAVQAGILSGKATSADTSDLLLLDVVPLSLGVAMEGNIFAPVIS
RSTTVPCLKKRTFTTVADNQQTVQFPVYQGERVNCEDNTSLGEFTLAPIPPMRAGEAVLE
CVFEVDVNGILKVTATEKTSGRSANITIANSVGKLSSGEIEKMISDAEAFKSNDEAFSKR
FEAKQQLESYIGRVEEIVTDPTLSLKLKRGQKEKIEQTISEAMATLEITESSAEDLKKQE
LALKRLVTKAMSSR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgaagtttacgacggtgccattggtatcgatctgggtaccacctactcttgc
gtggccacctacgagggtaccaatgtcgaaatcattgccaacgagcagggttccttcacc
actccctcattcgtctccttcaccgacaaggagcgtttgattggtgatgctgccaagaac
aatgccgctatgaaccccaagaacaccgtcttcgatgccaagcgtctgatcggtcgccgc
tacgatgaccccaccgtcaagaaggatattgagtcctggcctttcaccatcattgatgat
gctggccagcccaagatccaggtcgagtacctcggcgaaaagaaggagttctctgcccag
gagatctctgccatggtcctcaccaagatgaaggaaattgccgagaccaagctcggtaag
aaggtcgagaaggccgtcatcactgttcctgcctacttcaacgacaaccagcgtcaggct
accaaagatgccggtgctattgctggtctcaacgtccttcgtatcattaacgaacctact
gctgccgctattgcctacggtctgggctctggaaagtccgagaaggagcgcaacgtcctg
atctacgatttgggcggtggtactttcgatgtctctcttctcaacatccagggcggtgtt
ttcaccgtcaaggctaccgctggtgacacccatcttggtggccaagactttgatacgaac
ctgttagaacattgccgcacagcattcacgcgcaaaaccaagaaggaccttagtggtgat
gcccgtgcgctgcgaagactccgtactgcttgcgagcgtgccaagcgtaccctgtccagc
ggtgcccaggccaccattgagatcgactctctcttcgatggtgaagacttcaccatgacc
atcacccgtgcccgtttcgaggaactcaatgccaaggctttcgctggcactctcgagccc
gttgctcaggttctcaaggatgctgccatcgagaagtctgctgttgacgagatcgttctg
gttggtggttccactcgtatccccaagatccagaagctcttgtctgagttcttcgatggt
aagaaacttgagaagagcatcaaccccgacgaggctgttgcctacggtgctgccgtccag
gccggtattctctcgggcaaggccacctccgctgatacctctgacctcctgcttctcgat
gtcgtccctctgtctctcggtgtcgctatggagggcaacatcttcgccccagttataagt
cgatctacgactgtaccttgcttgaagaaaagaaccttcaccactgttgccgacaaccag
cagaccgttcagttccccgtctaccagggtgagcgcgtcaattgtgaggacaacacctcg
ctgggagagttcactcttgctcccattcctcccatgcgtgctggcgaggccgtcctcgag
tgtgtcttcgaggtggatgttaacggtatcctgaaggtcactgccactgagaagacatct
ggccgcagtgccaacatcaccattgccaactctgtcggcaagctctcctctggtgagatc
gagaagatgatctctgacgctgaggccttcaagagcaacgatgaggctttcagcaagcga
tttgaggccaagcagcagctcgagtcctacattggccgtgtggaggagattgtcaccgac
cccactctgtctctcaagctcaagcgtggccagaaggagaagattgagcagaccatctcc
gaagccatggctactcttgaaatcaccgaaagctctgccgaggacctcaagaagcaggag
cttgcccttaagcgccttgttaccaaggccatgtcctcccgataa

DBGET integrated database retrieval system