KEGG   Metarhizium acridum: MAC_07633Help
Entry
MAC_07633         CDS       T03104                                 

Definition
(RefSeq) protein phosphatases PP1 regulatory subunit sds22
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
maw  Metarhizium acridum
Brite
KEGG Orthology (KO) [BR:maw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:maw01009]
    MAC_07633
Protein phosphatases and associated proteins [BR:maw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MAC_07633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 19251944
NCBI-ProteinID: XP_007813973
UniProt: E9ECN5
Position
Unknown
AA seq 377 aa AA seqDB search
MSSAPDKETDHPHHIDIQDDRVAPREEGDASPGMRNSKGWDGKLRISKSALLSNPEALSD
PEYSDDSNVLPGEEIRADEDLLESESSDSEEIMCSHSRIRSIPSLRLERFKNVARICLRQ
NSIQEIEGLAPLAGTLKDLDLYDNLISHMRGMDELKNLVCLDLSFNKIKHIKNISHLTEL
KELFLVANKISKIEGLDTLQKLKSLELGSNRIREMRNLDNLQNLEELWVAKNKITELTGL
GGLPSLRLLSIQSNRIRDLSPLKEVPQLEELYIAHNALESLEGIEGSTNLTILDISNNQI
RSLKGLEGLTRLEEVWASYNQIGDFVEVEKVLKDKKNLTTVYFEGNPLQLRGPALYRNKV
RLALPQVSQIDATFVRV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgcgccagacaaagagaccgaccaccctcatcacattgacattcaagatgat
cgcgtggcgccacgcgaagaaggagatgcaagtccgggcatgagaaacagcaaaggctgg
gatgggaagctccgaatctccaaatccgctctgctgtccaaccccgaggcgctctccgat
cctgagtactccgatgacagcaatgtcctacctggagaagagattagagctgacgaagat
ctactcgaaagtgagagctccgacagcgaggaaatcatgtgttctcattcccgtatcaga
tctatcccttcccttcgactcgagcgtttcaaaaacgtcgcccgcatatgccttcggcaa
aatagtatacaagaaatcgaaggtctggccccccttgcgggcacattgaaagacttggat
ctctatgacaacctgatttcgcatatgcgtggcatggacgaacttaaaaatctcgtctgt
ctggacttgagctttaacaaaatcaagcacatcaagaatatcagccacctgacggagctc
aaggaattatttcttgtcgccaacaagatcagcaaaattgagggacttgatacgttacag
aaacttaaatctctagagcttggatcaaaccgcattcgtgagatgagaaacctcgataat
ctccaaaatttagaggagctgtgggtggctaaaaataaaatcaccgagcttactggtctg
ggtggcctgccgagccttcgtcttctcagcattcagtcaaacagaatcagagacctatca
ccactaaaggaggtgcctcagcttgaagagctctacattgcacacaacgctttagagtcg
ttggagggtattgaaggaagcaccaatttaaccatactagacatctccaacaaccaaatt
cgcagtctcaaaggcctggaagggttgaccaggcttgaagaagtctgggccagctacaac
cagatcggggactttgtggaggtagaaaaggtgttaaaggacaagaaaaatctgaccact
gtctattttgaagggaatccgcttcagctccggggaccagctctatacagaaacaaggtc
cgattggctttgccacaagtcagccagatcgatgctacttttgttcgagtatga

DBGET integrated database retrieval system