KEGG   Metarhizium acridum: MAC_08103Help
Entry
MAC_08103         CDS       T03104                                 

Definition
(RefSeq) flavoprotein family
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
maw  Metarhizium acridum
Pathway
maw00130  Ubiquinone and other terpenoid-quinone biosynthesis
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MAC_08103
Enzymes [BR:maw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     MAC_08103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 19252414
NCBI-ProteinID: XP_007814443
UniProt: E9EE05
Position
Unknown
AA seq 212 aa AA seqDB search
MATSQSGSNGHAPPTGALLPHRRRKKIIVAMTGATGAILGIKTLLALRQLNVETHLITSK
WADSTLKYETDYTTQAVRALADHVHSNHDMSAPVASGSYRVDGMIIIPCSMKTLAAISSG
YCDDLISRAADVMLKERKRLVLATRECPLSGIHIKNMATVTQNGGIIFPPVPAFYTRPSC
IDDIVAHTVGRILDLFDLDSEEFERWQGFQKE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaagtcaatctggctcaaacggccatgctcccccaaccggggctttactacca
catcggcggcgcaagaaaatcattgtggccatgacgggagcaacaggtgccattctcggc
atcaagacgctgctggctctccgccaactcaacgtcgagacgcacctcatcacgagcaag
tgggcagacagcacgctcaagtacgagaccgactacacgacgcaggcagtccgggcgctc
gccgaccacgtccacagcaaccacgacatgtctgcaccagttgccagcggctcgtaccgc
gtggacggcatgattattattccttgcagcatgaagacgcttgccgccattagctcgggc
tactgcgatgacctcatttccagagctgccgatgttatgctcaaggaacggaagagactt
gtcttggcgacgcgggagtgccccctgagcggcatacacatcaagaacatggctacggtt
acgcaaaacggggggattatattcccaccagtgccggcgttttacactagaccctcctgc
atagatgacattgtcgcccacacagtggggaggatattggatttgttcgatttggatagt
gaggaatttgagcggtggcaaggcttccagaaggagtag

DBGET integrated database retrieval system