KEGG   Metarhizium acridum: MAC_08166Help
Entry
MAC_08166         CDS       T03104                                 

Definition
(RefSeq) invertase precursor
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
maw  Metarhizium acridum
Pathway
maw00052  Galactose metabolism
maw00500  Starch and sucrose metabolism
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MAC_08166
   00500 Starch and sucrose metabolism
    MAC_08166
Enzymes [BR:maw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MAC_08166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19252477
NCBI-ProteinID: XP_007814506
UniProt: E9EE68
Position
Unknown
AA seq 574 aa AA seqDB search
MLPTSTKIHTALLGALYLANWCLGQNSSTQYVGANVPSGTPIVGSYGGQYRPQVHFSPPS
HFMNDPNGMFRDQNGTWHLYYQYNPTKSVAGNQHWGHATSQDLYHWTNQPIALFPPKKNV
YIFSGSTVIDKNNTSGLFGNQSNGVVAIYTLAEYLDDGSPGPQSQAIAYSYDSGFTFTPY
DGNPVIPSNSSQFRDPKVIWYEDHWVMVVAYAQEFAIGIFTSPDLIEWTHASNFSNQGLL
GLQWECPNLVRMPLYMEDGQRQDDVWTMLISINPGAPVGGSITEYYPGTFNGTHFEAIDS
VARIADFGKDNYAGQFFFGVPDDEDPVSIAWASNWQYTQTVPTAQEGWRSAMSLPRRNCL
TRIDRVGWKLISSPYDMRPIMGRNLAYNQSLGNGTLTIDFSDTASNAVYWEVDVTGLPKQ
GIPEMATLNFTFLSPITAEYIRGGYYFGGDNPFYFDRGGAKGFDNVFFTDKLSTNSLFRN
GSWSMSGVMDRSILELFLNGGVDSATATFFATRPLTCLIISASSLPHGTRVSARVNALKS
SWQQMEDPRDGLVHGNISTRETASEAMKHLLQSM
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgacaagcactaagattcacacggcactacttggtgctctataccttgcaaat
tggtgtcttggacagaattcttctactcagtacgttggagccaatgtcccatctggcaca
cccattgttggcagctatggagggcaatatcgtcctcaagtgcacttttcgccccccagc
cacttcatgaatgacccgaatggcatgtttcgggaccaaaacggcacatggcacctctat
taccagtacaaccctacaaagagtgttgcgggaaaccaacattggggacatgcgacctcc
caagatctataccactggacaaaccaaccaattgccctgttccccccgaagaagaatgta
tacatcttttctggaagtacagtcattgacaagaacaacacttctggtctctttggcaac
cagtccaatggtgttgttgccatttatacattggccgaatatttagatgacggcagcccc
ggcccccaatctcaggccatcgcctactcgtatgacagtggcttcaccttcactccgtat
gacggcaaccctgtgatccccagcaactcctcgcagtttcgcgatccaaaggtcatctgg
tacgaagaccactgggtaatggtggttgcttacgcccaggaattcgcaattggcatattc
acctcgccagatctgatcgaatggactcatgccagcaacttctccaaccaagggcttctg
ggtctacagtgggaatgcccaaacctagtgcgcatgccgctatacatggaagacggacaa
agacaagacgatgtgtggactatgctaatcagcatcaacccaggggcaccggtgggtggt
tctattacagaatactaccctggaactttcaacgggacccattttgaagctattgattca
gttgcccgcattgccgactttggcaaggacaactatgccgggcagttcttttttggtgtc
ccagacgacgaagatcctgtgtcgattgcgtgggcatctaattggcagtatacccagact
gttccgaccgcacaggagggctggcgtagtgcaatgagtctccctcgccggaattgcttg
acaagaattgaccgtgttggctggaaactgataagcagcccctatgacatgcggccaatc
atggggagaaatctagcgtataaccagagcctcggcaatggaaccttgacgattgacttt
tcagacacagcctccaatgcggtatattgggaggtggatgtgactggtttaccaaagcaa
ggaataccggaaatggccaccttgaatttcacgtttcttagtcccataacagcagagtac
atcagaggggggtattacttcggcggcgacaatccgttctattttgacagaggcggtgca
aaaggcttcgacaacgtctttttcaccgacaagctatctacaaatagtttgttccgtaac
ggtagctggtcgatgagcggggtgatggatcggtccatacttgaattatttctcaatggc
ggcgtagacagtgctacagcgactttcttcgccacacgaccgctgacatgcttgatcatc
agtgcgtccagtttgcctcatggcacacgggtgagtgctcgtgtcaatgctctaaaaagt
agctggcagcaaatggaagacccaagagatggcttggtgcacgggaacatctccacgcgg
gaaacggcatcagaggccatgaagcacttgctgcagtccatgtga

DBGET integrated database retrieval system