KEGG   Metarhizium acridum: MAC_08293
Entry
MAC_08293         CDS       T03104                                 

Definition
(RefSeq) C-14 sterol reductase, putative
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
maw  Metarhizium acridum
Pathway
maw00100  Steroid biosynthesis
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Module
maw_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MAC_08293
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MAC_08293
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF4328 DUF883_C
Other DBs
NCBI-GeneID: 19252604
NCBI-ProteinID: XP_007814633
UniProt: E9EEJ5
Position
Unknown
AA seq 427 aa
MASPVASWKATGWMLGYYLLSLLLYRVLPATEVYGTKLRESGRPLKYRFNEPVLIQWAGL
AFSSTVVQLAACAVGTYIYGADFAVWTFIDSNYLQLLTASLVLAYAISAFVYIKSFSVKP
GNKDLRELSRGGHTGNVIYDFYIGRELNPRVTLPFFGEIDLKAWLEMRPGLTGWALLDLA
FVAKQYRNYGFLSNSILFITAVQIYYVLEGQYAETALLGMMDITTDGLGFMLTFGDIAWV
PFLYSTQCRYLSIHPVHLSSAGIAAVGVAFAIGFFIFRSANNQKALFRQSPDDPRVGRMS
YIQTRRGTRLLTSGWWGMARHINYFGDWLQASPFTLPTGIAGYVMLPAGSAVANASAGGF
AMADGREVRQEGARGWGMVYTYLYALYFAMLLIHREGRDDAACGEKYGEDWERYKKQVKW
RILPGVY
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcctcgccggttgcaagctggaaagcaaccggctggatgctgggctactatcttctc
agtttgctcctctaccgcgtgctcccggccactgaggtatacggcaccaagttgagagag
tcgggtcgacccctgaaatatcggttcaacgagcccgtactgattcaatgggccgggtta
gcattctcgtctacggtggtgcagctggccgcatgtgccgtggggacctacatttacggc
gcagactttgccgtctggacttttatcgacagcaactacctgcagttgctgacggccagc
ctcgtccttgcgtacgccatctcggctttcgtgtacatcaagagcttttccgtcaagcct
ggcaacaaggatctgcgagaactatctcgagggggccacactggaaatgtaatctacgac
ttctacattggccgcgaactgaatcctcgcgtcaccctcccattctttggcgagattgac
ttgaaggcctggcttgaaatgcgacctggcctgacgggatgggctcttctcgaccttgcc
tttgttgcgaaacagtaccgcaactacggattcctttccaacagcattctattcatcacg
gcggtgcagatatattatgtccttgaggggcagtatgccgagacggctctgctaggcatg
atggacataaccactgatgggctgggattcatgctcacctttggagacatcgcctgggtc
cccttcttgtactcgacgcaatgccggtacctgtccattcacccggtccatctgagctcg
gcgggaatcgcggcagtgggcgtagccttcgccattggcttcttcatcttccgctcggcc
aacaaccaaaaggccctctttcgacagtccccagacgacccgagagttggccgcatgtcg
tacatacaaaccaggcgcggcactcgacttctcacgtctggctggtggggcatggcccgt
cacatcaactactttggcgactggttgcaagcctctccattcaccctacctacgggcatt
gctggctacgtcatgttgcccgctggaagtgccgtggccaacgccagcgcgggaggcttc
gccatggcggatggccgagaggtgaggcaggagggtgctcggggatggggaatggtttac
acgtacttgtacgcgctgtactttgccatgttgcttatccatcgtgagggccgggatgat
gcggcgtgcggcgagaagtatggcgaggactgggagaggtacaagaagcaggtcaagtgg
cgcatcttgcccggcgtgtactga

DBGET integrated database retrieval system