KEGG   Metarhizium acridum: MAC_08528
Entry
MAC_08528         CDS       T03104                                 

Definition
(RefSeq) C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
maw  Metarhizium acridum
Pathway
maw00100  Steroid biosynthesis
maw01100  Metabolic pathways
maw01110  Biosynthesis of secondary metabolites
Module
maw_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:maw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MAC_08528
Enzymes [BR:maw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MAC_08528
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 19252839
NCBI-ProteinID: XP_007814868
UniProt: E9EF80
Position
Unknown
AA seq 492 aa
MSSSKTAAKSAAPAEHGYEFFGPPGAFGISFGLPILVYVFTFVCNDISGCPAPSLLSPRS
LSLEQLKIEVGWPQNGIWGLASWEATGAVLAYYLLNLILYRVLPATETDGTVLSSGGRLK
YRFNTFYSNTVTLAALAAGTVAQGAEFPVWVFISENYLQILTANIGIAYAIATFVYVRSF
SVKPGNKEFRELAAGGHTGNLLYDWFIGRELNPRVTIPLIGEVDLKEWCELRPGMMGWII
LNCSWCAQQYRNFGFVTDSIICITIVQALYIIDSWWFEPAILTTMDITTDGFGMMLAFGD
LVWVPFIYSMQTRYLSVHPLSLGPAGLAGTLSLIGLGFYIFRSANSQKNTFRTNPSDPSV
AHLEYIETKTGSKLLISGWWGIARHINYLGDWIQSWPYSLPTGLAGYQILAAGAGAAGAA
GQGAYIMKDGREVIQGNARGWAIPITYFYIVYFAVLLIHRERRDDEKCHRKYGEDWDKYK
KIVRWRIIPGIY
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgtcctcctcgaagactgcggccaagtctgcagctccagctgagcacggatacgagttc
ttcggcccacccggtgcctttggcatctcgtttggtctacccatcctcgtctacgtcttc
actttcgtgtgcaacgacatatccggatgccccgcgccatcgctgctgagtccgcgctcc
ttgtcactcgagcagttgaagattgaagtcggctggccacagaatggaatatggggtctc
gccagctgggaagcgaccggtgctgttcttgcctactacttgctgaacctcatcttatac
cgcgttttgcctgcaaccgagacggacgggactgtcttgagctccggcggacgtctcaag
taccgattcaacacgttctactccaacacggttactttggcagccctcgcagccgggact
gttgcccaaggcgccgaattccccgtttgggtctttatcagcgagaactacctccagatt
ctgacggctaatatcggaattgcctatgcaatcgccacttttgtttacgtccgcagcttc
agcgtcaagcctggaaacaaggaatttcgcgagcttgcagccggcggccacaccggcaac
ctgctctacgattggttcattggccgcgaactcaaccctcgcgtcacaatacccctgatt
ggagaagttgacctcaaggagtggtgtgagctgcgacctggcatgatgggctggatcatc
cttaactgctcttggtgtgctcagcaataccgcaactttggcttcgtcaccgacagcatc
atctgcatcacgattgtgcaagccctatacataatagattcatggtggttcgagcctgct
attttaaccaccatggatatcacgaccgacggttttggcatgatgcttgcctttggcgac
ctcgtctgggtgccctttatctactccatgcaaactcgttacctctccgtgcaccctctg
tcgcttggtcccgccggcctcgcaggtaccctttccctcatcggccttggcttctacatc
ttccgctccgccaacagccagaagaacactttccgcacaaaccccagtgaccccagcgtc
gctcacctcgagtatattgagaccaagacgggcagcaagcttctaatcagcggctggtgg
ggaatcgcccgtcacatcaattatctcggcgattggatccagtcttggccatacagtctc
cccaccggacttgctggctaccagattctggctgctggtgcaggcgccgccggcgccgcc
ggccaaggcgcgtatatcatgaaggacggccgggaggttattcagggcaacgcgcgaggc
tgggctatccccattacctacttctacattgtatactttgccgtgctgcttatccatcgt
gagcgccgcgacgacgagaagtgccatcgcaagtacggagaggactgggataagtacaag
aagattgtacgttggagaatcattcctggtatttactag

DBGET integrated database retrieval system