KEGG   Metarhizium acridum: MAC_09487Help
Entry
MAC_09487         CDS       T03104                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
maw  Metarhizium acridum
Pathway
maw00970  Aminoacyl-tRNA biosynthesis
maw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MAC_09487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:maw03029]
    MAC_09487
Enzymes [BR:maw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MAC_09487
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MAC_09487
Mitochondrial biogenesis [BR:maw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MAC_09487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 19253798
NCBI-ProteinID: XP_007815827
UniProt: E9EHY9
Position
Unknown
AA seq 624 aa AA seqDB search
MKMRRVSISEVGRYLLHGSISKRGCLVGRHTLGHGAVALRSPISLSGHFRAASTIATPTA
SSNESVIPLRKQLKEEAKLAKKQGKKKSKGESQTVDGWELTVGIEIHAQLNTARKLFSPA
TTSFNDEPNSHVALFDVSMPGSQPLIQKETLLPALRAALALNCEIQSVSRFDRKHYFWWD
QPAGYQITQYYEPFAKNGHITLYARDGIAAEDGEGVTVGIKQVQLEQDTAKTLTQTGNVH
WLDFNRVGVPLIEIITEPDMHHPRTAAALVRKIQLLLNTVDTCVSGMETGGLRADVNVSV
RKTDDPSCKLGTRTEIKNLGTIKAVEDAIIAERDRQIQELEAGRSIVGETRGWSLGSKET
RRLRGKEGEVDYRYMPDPDIAPLVIGNDLVEHLRTSLAVLPDAELDTLINDFGLTAKDAL
SLITLDNGARVQYFYKVLDGLDRKMQVELADGADKTRPDLKSYATLAANWVTHGLGRLTT
YKAGPLASAELLFSADGECAQVPAADLSQLLYHLCLNQITGKVAKELLLSIYLEELEGGV
EEAIEANGLWFREISETEYRQLAKEAVEGEDKVLQEFVGYKKFPQGKLMYLVGKMMKMGP
TERINAATAEAAMRAQIEASQGRG
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaggcgagtgtcgatctccgaggttgggagatatcttctccatgggagcatc
tcaaagcgaggctgtttggtgggacgacatactctgggacacggcgccgtggctttgcgg
tcgccaatttccttgtctgggcactttcgagccgcatcgacaattgcgacaccgaccgca
tcttcgaatgaaagcgttattcccttgcgcaagcagctaaaggaggaggcaaagcttgcc
aagaagcaaggcaagaagaaatcaaaaggcgaatcccagactgtggatggttgggaattg
actgtgggcattgaaattcatgcacagctcaacaccgctcggaagctcttttctcctgca
accacgtcgttcaacgacgagcccaacagtcacgtggccctttttgatgtctccatgcct
ggaagtcagccgctgatacaaaaggagacactgcttccagcactgcgggctgccttggcc
ctcaactgcgagatccagtctgtaagtcgctttgaccgaaagcattatttctggtgggac
cagccggctggatatcaaatcacccaatactatgagccttttgctaagaatggtcatatc
acactttatgctcgggacggcattgctgctgaagatggcgaaggtgtcaccgttggtatt
aaacaggtgcagcttgagcaggataccgccaaaacgttgacacaaaccgggaatgtgcat
tggctagatttcaaccgagtgggtgtgcctctgatcgagatcattactgagcccgacatg
catcatcctcgaacggctgccgcactggtgcgcaaaatccagcttttgctcaacactgtc
gacacttgtgtttcgggaatggaaactggcggtctcagagcggacgtgaatgtgtcggtc
cgcaagactgacgacccttcttgcaaactgggcacacggacagaaatcaagaaccttggt
accataaaagccgtcgaggacgccattatcgccgaaagagatcgccaaattcaggaacta
gaagccggtaggagcatagttggtgagacccgaggatggtcacttggatcgaaagagacc
cggaggttgcgaggcaaggaaggcgaagtcgactatcgttacatgcctgatcctgatatc
gcgccgcttgtgataggaaatgatttggttgagcatcttcgaacttcgttggccgtgttg
ccagacgcggagctggatacgttaataaacgattttggactgaccgccaaagatgctcta
tcgctaattactctggataatggagctagggttcagtatttttacaaagtgttggatggc
cttgaccgaaagatgcaagtcgaacttgcagatggggctgacaagactagaccggatttg
aagagctatgcaactcttgctgcaaattgggtcacgcacggactgggccggttgacaacg
tacaaagccgggccattggcctcggccgagctgctcttctcagcggacggtgaatgcgcg
caagttcctgctgctgatttgtcccaactcctctatcatctgtgtctgaaccaaattacg
ggcaaggtcgccaaagaactccttctgtctatttatctcgaagaactggaaggtggtgta
gaagaggccatcgaggcaaacggcttgtggttcagggagatttcggagactgagtatcga
cagttggcaaaagaggctgtggaaggagaagacaaggtcttgcaagaatttgttggttat
aagaagtttccgcaaggaaagttgatgtaccttgttggaaagatgatgaagatgggcccc
acggagcggattaatgccgcgactgctgaggctgctatgagagcgcagattgaagcctca
caaggccgaggttga

DBGET integrated database retrieval system