KEGG   Candidatus Methanomethylophilus alvus: MMALV_03970Help
Entry
MMALV_03970       CDS       T02624                                 

Definition
(GenBank) Methyl coenzyme M reductase beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
max  Candidatus Methanomethylophilus alvus
Pathway
max00680  Methane metabolism
max01100  Metabolic pathways
max01120  Microbial metabolism in diverse environments
max01200  Carbon metabolism
Module
max_M00356  Methanogenesis, methanol => methane
max_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:max00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MMALV_03970
Enzymes [BR:max01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     MMALV_03970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: AGI85141
UniProt: M9S9U8
Position
361184..362512
Genome map
AA seq 442 aa AA seqDB search
MPKYEDVIDLYDDYGKRIAKDVPLEAISPLRNKAIQKIASLTKRTIAVNLAGIEKALATG
QIGGSKIAGKEIEVPLVKDAKKLADDIKAMVQVTEGDDTVVEVKNDGKLIVVIVPEDRLN
AGVEYTTGFTAVAAAITEAIIDRYKVPMYKANMVKGAVWGQYPQTVNFAGSNIKTILEVP
QMNEGAGFALRNIMSNHVVALVQRNAMQGAALSSLFETCAAYEMGDAIGPFERQHLLSLA
YQGLNANNLVYSLVKKNGKTGTVGTVVESLMERAIDDGVIRVKETLPSGYNVYTTDDLPK
WNAYAAAGEVAAVMVNVGAARAAQGVPSTVLYYNDLLEHESALPGVDYGRAEGVGVGMSF
FSHSIYGGGGPGLFHGNHVVTRHAKGTLIPAVTAGNCLDGGTQTFSAEATSGLFKDVFGG
MPEFNTPMQFVGAEAKKIKNKL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaatacgaggacgtaatagacctgtatgatgactacggcaagcgcatcgcaaaa
gatgtgccgctggaagccatcagtccgttgcgcaacaaggcaatccagaaaattgcctct
ctgaccaagaggaccattgcggtcaacctggccggaatcgagaaagctctcgcgaccgga
cagatcggcggcagcaagatcgctggaaaagagatcgaggtgcctctcgtaaaggatgcc
aagaaactcgccgacgacatcaaagccatggtgcaggtcaccgagggcgacgacaccgtt
gtcgaggtcaagaacgacggaaagctcatcgttgtcattgtccctgaggacaggctcaac
gccggtgtcgagtacaccaccggtttcaccgcagtcgctgcggccatcaccgaggccatc
atcgacaggtacaaagtacctatgtacaaggccaacatggtaaagggtgcagtatgggga
cagtacccccagaccgtcaacttcgctggatccaacatcaagaccattcttgaggttccc
cagatgaacgagggtgccggtttcgcactcaggaacatcatgtccaaccacgtggtcgcc
ctcgtccagaggaacgccatgcagggagcggccctctcgtctctcttcgagacctgcgcc
gcctacgagatgggagacgccatcgggcccttcgagaggcagcaccttctgtccctcgcc
taccagggactgaacgccaacaacctcgtctactcgctcgttaagaagaacggaaagacc
ggaaccgtcggaactgtcgtcgagtctctcatggagagggcaatcgacgacggagtcatc
cgcgtgaaagagacccttccgtccggatacaacgtgtacaccaccgacgacctccccaag
tggaacgcctacgcagcagccggagaggttgccgctgtcatggtgaacgtcggagctgcc
cgtgcagcccagggtgtcccgtccactgtcctgtactacaacgacctgctcgagcacgag
tctgcactgcccggtgtcgactacggacgtgcggagggtgtcggtgtcggtatgtccttc
ttctcccactctatctacggtggtggaggacctggactgttccacggaaaccacgtcgtt
accaggcatgctaagggaaccctcatacccgcagtcaccgcaggaaactgccttgacggt
ggaacccagaccttctctgcagaggccacttccggactcttcaaggatgtcttcggagga
atgcccgagttcaacactccgatgcagttcgtcggagcagaggcgaagaagattaagaac
aagctctga

DBGET integrated database retrieval system