KEGG   Mycobacteroides abscessus subsp. bolletii MA 1948: LA62_04230Help
Entry
LA62_04230        CDS       T03353                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
may  Mycobacteroides abscessus subsp. bolletii MA 1948
Pathway
may00071  Fatty acid degradation
may00072  Synthesis and degradation of ketone bodies
may00280  Valine, leucine and isoleucine degradation
may00310  Lysine degradation
may00362  Benzoate degradation
may00380  Tryptophan metabolism
may00620  Pyruvate metabolism
may00630  Glyoxylate and dicarboxylate metabolism
may00640  Propanoate metabolism
may00650  Butanoate metabolism
may00900  Terpenoid backbone biosynthesis
may01100  Metabolic pathways
may01110  Biosynthesis of secondary metabolites
may01120  Microbial metabolism in diverse environments
may01130  Biosynthesis of antibiotics
may01200  Carbon metabolism
may01212  Fatty acid metabolism
may02020  Two-component system
Brite
KEGG Orthology (KO) [BR:may00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA62_04230
   00630 Glyoxylate and dicarboxylate metabolism
    LA62_04230
   00640 Propanoate metabolism
    LA62_04230
   00650 Butanoate metabolism
    LA62_04230
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA62_04230
   00072 Synthesis and degradation of ketone bodies
    LA62_04230
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA62_04230
   00310 Lysine degradation
    LA62_04230
   00380 Tryptophan metabolism
    LA62_04230
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA62_04230
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA62_04230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA62_04230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:may04147]
    LA62_04230
Enzymes [BR:may01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA62_04230
Exosome [BR:may04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA62_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 GYD Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AIR36921
Position
complement(832135..833289)
Genome map
AA seq 384 aa AA seqDB search
MSRGVAVVGVGQSKQAKKREVTIAALVREAVDGALADAELTFGDIDAIVLAKTPDLFDGV
MNPELYLADAIGARGLPVTRVFTGGSVGGHAAIYAAHLIQARLAGRVLVVAYSKESEGNF
TWALSRPLPFSAQLGAGAGGHFAPVIREYIRRSHAPEHIGWQVAVNHRLNATRNPYAHIH
KPDITIEEVRNSPMLWDPIRFLESCPSSDGSCAVVISSEMHARLAPRPPAWIHGTGWRTE
TGHFAGRDEVNPRAGQECAAAAYREAGITDPGTEVDVSELYIPYSWYEPMWMENIGLAPE
SSGWRAVDEGHTAFGGRHPINPSGGVLSGNPTGATGLLRFAEAALQVRGLAGEHQVDGAR
RAIGHAMGGASQFHALWVVGSEKP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcggtgtcgccgtcgtcggtgtcgggcaaagcaagcaagccaaaaaacgtgag
gtgaccatcgccgcgctggtccgcgaagcggtggacggggcgctggccgacgccgagctg
accttcggcgacatagacgcgatcgtgctggccaagacacccgatctattcgacggcgtc
atgaacccggagctgtacctcgccgacgcgatcggcgcgcggggtctgccggtcacgcgc
gtattcaccggtggcagcgtcggcggtcacgccgccatctacgccgcgcacctgatccag
gcccggctggccggacgggtattggtggtcgcatattccaaagagtccgagggcaatttc
acgtgggcactgtcacgtccgttgccattcagtgcccagttgggagcgggcgccggcggc
cacttcgcaccggtgatccgggagtacatccgccgctcgcacgcaccggaacatatcggc
tggcaggtggcggtgaatcaccgcctcaacgccacccggaacccctacgcgcatatccac
aaacccgatatcaccatcgaggaggtgcgcaactccccgatgctgtgggacccgatccga
ttcctggagtcgtgcccgtcctcggatggctcatgtgccgtcgtgatttcttcggagatg
catgcgcggctcgctccccgaccgccggcctggattcatggcaccggatggcgcaccgaa
acaggacatttcgcgggccgagacgaagtgaacccgcgcgccggacaggagtgcgccgcc
gccgcgtatcgcgaggcgggcatcaccgatcccggcaccgaagtggatgtctccgagctc
tacattccctacagctggtatgagccgatgtggatggagaacatcggtctggcaccggag
agttcgggctggcgcgccgtcgatgagggccacaccgcattcgggggccggcacccgatc
aacccgtccggaggcgtgctctccggcaatccgaccggtgccaccggcctactccgattc
gccgaggccgccctgcaggtgcgggggctcgcgggtgaacaccaggtcgatggagccaga
cgtgcgataggccacgccatgggcggggcgtcacagttccacgcgttgtgggtggtggga
agtgagaaaccatga

DBGET integrated database retrieval system