KEGG   Mycobacteroides abscessus subsp. bolletii MA 1948: LA62_06055Help
Entry
LA62_06055        CDS       T03353                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
may  Mycobacteroides abscessus subsp. bolletii MA 1948
Pathway
may00071  Fatty acid degradation
may00072  Synthesis and degradation of ketone bodies
may00280  Valine, leucine and isoleucine degradation
may00310  Lysine degradation
may00362  Benzoate degradation
may00380  Tryptophan metabolism
may00620  Pyruvate metabolism
may00630  Glyoxylate and dicarboxylate metabolism
may00640  Propanoate metabolism
may00650  Butanoate metabolism
may00900  Terpenoid backbone biosynthesis
may01100  Metabolic pathways
may01110  Biosynthesis of secondary metabolites
may01120  Microbial metabolism in diverse environments
may01130  Biosynthesis of antibiotics
may01200  Carbon metabolism
may01212  Fatty acid metabolism
may02020  Two-component system
Brite
KEGG Orthology (KO) [BR:may00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA62_06055
   00630 Glyoxylate and dicarboxylate metabolism
    LA62_06055
   00640 Propanoate metabolism
    LA62_06055
   00650 Butanoate metabolism
    LA62_06055
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA62_06055
   00072 Synthesis and degradation of ketone bodies
    LA62_06055
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA62_06055
   00310 Lysine degradation
    LA62_06055
   00380 Tryptophan metabolism
    LA62_06055
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA62_06055
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA62_06055
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA62_06055
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:may04147]
    LA62_06055
Enzymes [BR:may01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA62_06055
Exosome [BR:may04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA62_06055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AIR37271
UniProt: A0A1M9ATV1
Position
complement(1205816..1207033)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAGKGSLVSMRPDDLAAQMVRAALDKVPALDPKDVDDLMLGCGQP
GGEAGFNIGRAVAVQLGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGHAFISAGVETV
SRFPKGTSDGWPDSHNPLYADAEARTATAAQGATEWHDPRNDGLTPDVYIAMGQTAENVA
LHTGISREDQDHWGVRSQNRAEKAIADGFFEREITPVTLADGTVVAKDDGPRAGTTYEAI
SQLKPVFRPNGTITAGNACPLNDGAAALVVMSDVRAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKRALANAGKSIGDIDLFEINEAFAVQVLGSARALGIDEDKLNVSGGAIALGH
PFGMTGARITATLLNNLTTYDKTFGVETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgtgatcgtttccactgcccgctccccgatcgggcgagccggcaagggc
tcgctggtgagcatgcggccggatgacctggccgcgcagatggtgcgcgccgccctcgac
aaggtgcccgcactggaccccaaggatgtcgacgacctgatgctgggctgcggtcagcca
ggcggcgaggccggtttcaacatcggtcgcgcggtggcggtacagctgggctacgacttc
ctgcccggcaccaccgtcaaccgttactgctcgtcgtcgctgcagaccacccgcatggcg
ttccacgccatcaaggccggcgagggtcacgcattcatttccgctggtgtggagacggtt
tcgcgctttccgaagggcacttcggacggatggccggacagccacaacccgctgtacgcc
gacgccgaggcccgcaccgcgaccgcggcacagggtgccaccgaatggcacgacccgcgc
aacgacggcctgacccccgacgtgtacatcgcgatgggccagaccgccgagaacgtggca
ctgcacaccggcatcagccgtgaggaccaggaccactggggcgtgcgcagccagaaccgg
gccgaaaaggccattgccgatggctttttcgagcgcgagatcaccccggtgacgctggcc
gacggtaccgtcgtggccaaggacgacggcccccgcgccggcaccacctacgaggccatc
agccagctgaagccggtgttccgccccaacggcaccatcactgccggtaacgcctgcccg
ctgaacgacggtgcggccgcgctggtcgtgatgagcgatgtgcgcgccaaggagctgggc
ctgaccccgctggcgcgcatcgtctctaccggtgtgtccggcctgtcgccggaaatcatg
ggcctgggcccgatcgaggccgtcaagcgcgcactggccaacgcgggcaagtcgattggc
gacatcgatctgttcgagatcaacgaggcgttcgccgtccaggtgctgggctcggcgcgc
gcgctcggcatcgatgaggacaagctgaacgtctccggcggtgcgatcgcgctgggtcac
cccttcggcatgaccggtgcccgcatcaccgccaccctgctgaacaacctgaccacctac
gacaagaccttcggtgtcgagaccatgtgtgtgggtggcggccagggtatggcgatggtc
atcgagcggctcgcctag

DBGET integrated database retrieval system