KEGG   Mycobacteroides abscessus subsp. bolletii MA 1948: LA62_19425Help
Entry
LA62_19425        CDS       T03353                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
may  Mycobacteroides abscessus subsp. bolletii MA 1948
Pathway
may00071  Fatty acid degradation
may00072  Synthesis and degradation of ketone bodies
may00280  Valine, leucine and isoleucine degradation
may00310  Lysine degradation
may00362  Benzoate degradation
may00380  Tryptophan metabolism
may00620  Pyruvate metabolism
may00630  Glyoxylate and dicarboxylate metabolism
may00640  Propanoate metabolism
may00650  Butanoate metabolism
may00900  Terpenoid backbone biosynthesis
may01100  Metabolic pathways
may01110  Biosynthesis of secondary metabolites
may01120  Microbial metabolism in diverse environments
may01130  Biosynthesis of antibiotics
may01200  Carbon metabolism
may01212  Fatty acid metabolism
may02020  Two-component system
Brite
KEGG Orthology (KO) [BR:may00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA62_19425
   00630 Glyoxylate and dicarboxylate metabolism
    LA62_19425
   00640 Propanoate metabolism
    LA62_19425
   00650 Butanoate metabolism
    LA62_19425
  Lipid metabolism
   00071 Fatty acid degradation
    LA62_19425
   00072 Synthesis and degradation of ketone bodies
    LA62_19425
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA62_19425
   00310 Lysine degradation
    LA62_19425
   00380 Tryptophan metabolism
    LA62_19425
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA62_19425
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA62_19425
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LA62_19425
Enzymes [BR:may01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA62_19425
Exosome [BR:may04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA62_19425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AIR39863
Position
complement(3870504..3872006)
Genome map
AA seq 500 aa AA seqDB search
MAFDPRTPVLVGTGQVNQRTDADTPFSEIPEPIDLMEQAARLAAGDAGATELLGAIDTIS
VANIFSWRYRDPGVLLGERLGAVPKRTFYTGPSGNSPQLLVNHAAADILAGDADVVLIGG
AEMWRSRNKMMATGVQPTWTIQDESVAEATVLGGRMDQVGGAETAIGLISPGHVYPLFEE
AIRIAGGVSIADHRAAMSQLWQRFNAVAVTNGHAWSNDAYTAEEIATPGPDNRWISSPYT
KLMNSNNMVEQGAVVLLTSVETALRLGISKDRWIFPLAGAQANDTFALSERHELHRSPAI
RLAGRRAFEIAGLGTDDVELVDIYSCFPSAVQVAAAELGLALDDPARPLTVTGGLTFAGG
PWCNYVTHSIATMAERLRERPGAKGLITANGGYLTKHAFGIYGTEPPASGFAYEDVQADV
DQEPRTEAADGYTGTAAVEAWTVNYGRDGSPFQTFVSVRTPTGARTFAKIDDRDASAHIA
DTDIAGASIEVAADGSARLN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgaccctcgcacgccggtcctcgtcggtaccgggcaggtcaaccagcggaca
gacgcggacactccgttctcggagatccccgaacccatcgatctcatggagcaggcggcg
cgcctggcggccggtgacgcgggagcgaccgagctgctcggcgcgatcgacacgatatcg
gtggcgaacatcttctcgtggaggtaccgcgaccccggagtgctgcttggtgagcgcctg
ggcgcggtgcccaagcgcaccttttacacgggccccagcggcaactcgccgcagttgttg
gtcaatcacgcggccgccgacatcctggccggggatgctgacgtggtgctcatcggtggc
gcggagatgtggcgttcacgcaacaagatgatggccaccggcgtacagcccacctggacc
atccaggatgagtccgtagccgaggcaacagttctcggtggccgcatggatcaagtcggt
ggcgcggaaaccgccatcggcctcatctcgccgggccacgtctacccgctcttcgaggag
gcgatacggatcgccgggggtgtgtccatcgccgaccaccgcgccgcgatgtcgcaactg
tggcagcggttcaacgcggtagcggtcaccaatggccatgcctggtccaacgacgcgtac
accgccgaggagatcgccacccccggccccgacaatcgatggatcagttctccgtatacc
aagctgatgaattcgaacaatatggtcgagcagggcgcagtggtgttgttgacctccgtg
gagactgcgctgcggctaggaatctccaaggaccgctggatatttccgctcgccggtgcg
caggccaacgacaccttcgccctcagtgaacgccatgaattgcaccggtcgccggccatc
cggctggcgggcagacgcgcattcgagatcgccggactgggcaccgacgatgtcgagctg
gtcgacatctactcgtgcttcccgtcggcggtgcaggtcgccgccgcagaactagggctg
gcactcgatgacccggcgcggccgctgacagtcaccggtggtctcaccttcgccggtggg
ccctggtgcaactacgtcacccactccatcgccaccatggcggagcggctgcgcgagcgt
ccgggggcgaagggcctgatcaccgccaacggtggatatctcaccaagcacgccttcgga
atctacggaaccgagccgcctgcatccggattcgcatatgaggatgtacaggccgacgtc
gatcaagaaccccggaccgaggccgccgacggctataccggtacggcagccgtggaggca
tggaccgtcaactacggacgggacggatcgccgttccagacgttcgtcagtgtgcgcacg
ccgacaggagcgcgcacctttgccaagatcgatgaccgagacgcctccgcgcacatcgcg
gataccgatatcgctggcgcctcaatcgaagtggcggcggacggatccgcgcgcctcaac
tga

DBGET integrated database retrieval system