KEGG   Mycobacteroides abscessus subsp. bolletii 103: LA61_04145Help
Entry
LA61_04145        CDS       T03329                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maz  Mycobacteroides abscessus subsp. bolletii 103
Pathway
maz00071  Fatty acid degradation
maz00072  Synthesis and degradation of ketone bodies
maz00280  Valine, leucine and isoleucine degradation
maz00310  Lysine degradation
maz00362  Benzoate degradation
maz00380  Tryptophan metabolism
maz00620  Pyruvate metabolism
maz00630  Glyoxylate and dicarboxylate metabolism
maz00640  Propanoate metabolism
maz00650  Butanoate metabolism
maz00900  Terpenoid backbone biosynthesis
maz01100  Metabolic pathways
maz01110  Biosynthesis of secondary metabolites
maz01120  Microbial metabolism in diverse environments
maz01130  Biosynthesis of antibiotics
maz01200  Carbon metabolism
maz01212  Fatty acid metabolism
maz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA61_04145
   00630 Glyoxylate and dicarboxylate metabolism
    LA61_04145
   00640 Propanoate metabolism
    LA61_04145
   00650 Butanoate metabolism
    LA61_04145
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA61_04145
   00072 Synthesis and degradation of ketone bodies
    LA61_04145
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA61_04145
   00310 Lysine degradation
    LA61_04145
   00380 Tryptophan metabolism
    LA61_04145
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA61_04145
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA61_04145
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA61_04145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maz04147]
    LA61_04145
Enzymes [BR:maz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA61_04145
Exosome [BR:maz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA61_04145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 GYD Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AIR32035
Position
complement(816956..818110)
Genome map
AA seq 384 aa AA seqDB search
MSRGVAVVGVGQSKQAKKREVTIAALVREAVDGALADAELTFGDIDAIVLAKTPDLFDGV
MNPELYLADAIGARGLPVTRVFTGGSVGGHAAIYAAHLIQARLAGRVLVVAYSKESEGNF
TWALSRPLPFSAQLGAGAGGHFAPVIREYIRRSHAPEHIGWQVAVNHRLNATRNPYAHIH
KPDITIEEVRNSPMLWDPIRFLESCPSSDGSCAVVISSEMHARLAPRPPAWIHGTGWRTE
TGHFAGRDEVNPRAGQECAAAAYREAGITDPGTEVDVSELYIPYSWYEPMWMENIGLAPE
SSGWRAVDEGHTAFGGRHPINPSGGVLSGNPTGATGLLRFAEAALQVRGLAGEHQVDGAR
RAIGHAMGGASQFHALWVVGSEKP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcggtgtcgccgtcgtcggtgtcgggcaaagcaagcaagccaaaaaacgtgag
gtgaccatcgccgcgctggtccgcgaagcggtggacggggcgctggccgacgccgagctg
accttcggcgacatagacgcgatcgtgctggccaagacacccgatctattcgacggcgtc
atgaacccggagctgtacctcgccgacgcgatcggcgcgcggggtctgccggtcacgcgc
gtattcaccggtggcagcgtcggcggtcacgccgccatctacgccgcgcacctgatccag
gcccggctggccggacgggtattggtggtcgcatattccaaagagtccgagggcaatttc
acgtgggcactgtcacgtccgttgccattcagtgcccagttgggagcgggcgccggcggc
cacttcgcaccggtgatccgggagtacatccgccgctcgcacgcaccggaacatatcggc
tggcaggtggcggtgaatcaccgcctcaacgccacccggaacccctacgcgcatatccac
aaacccgatatcaccatcgaggaggtgcgcaactccccgatgctgtgggacccgatccga
ttcctggagtcgtgcccgtcctcggatggctcatgtgccgtcgtgatttcttcggagatg
catgcgcggctcgctccccgaccgccggcctggattcatggcaccggatggcgcaccgaa
acaggacatttcgcgggccgagacgaagtgaacccgcgcgccggacaggagtgcgccgcc
gccgcgtatcgcgaggcgggcatcaccgatcccggcaccgaagtggatgtctccgagctc
tacattccctacagctggtatgagccgatgtggatggagaacatcggtctggcaccggag
agttcgggctggcgcgccgtcgatgagggccacaccgcattcgggggccggcacccgatc
aacccgtccggaggcgtgctctccggcaatccgaccggtgccaccggcctactccgattc
gccgaggccgccctgcaggtgcgggggctcgcgggtgaacaccaggtcgatggagccaga
cgtgcgataggccacgccatgggcggggcgtcacagttccacgcgttgtgggtggtggga
agtgagaaaccatga

DBGET integrated database retrieval system