KEGG   Mycobacteroides abscessus subsp. bolletii 103: LA61_07320Help
Entry
LA61_07320        CDS       T03329                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maz  Mycobacteroides abscessus subsp. bolletii 103
Pathway
maz00071  Fatty acid degradation
maz00072  Synthesis and degradation of ketone bodies
maz00280  Valine, leucine and isoleucine degradation
maz00310  Lysine degradation
maz00362  Benzoate degradation
maz00380  Tryptophan metabolism
maz00620  Pyruvate metabolism
maz00630  Glyoxylate and dicarboxylate metabolism
maz00640  Propanoate metabolism
maz00650  Butanoate metabolism
maz00900  Terpenoid backbone biosynthesis
maz01100  Metabolic pathways
maz01110  Biosynthesis of secondary metabolites
maz01120  Microbial metabolism in diverse environments
maz01130  Biosynthesis of antibiotics
maz01200  Carbon metabolism
maz01212  Fatty acid metabolism
maz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA61_07320
   00630 Glyoxylate and dicarboxylate metabolism
    LA61_07320
   00640 Propanoate metabolism
    LA61_07320
   00650 Butanoate metabolism
    LA61_07320
  Lipid metabolism
   00071 Fatty acid degradation
    LA61_07320
   00072 Synthesis and degradation of ketone bodies
    LA61_07320
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA61_07320
   00310 Lysine degradation
    LA61_07320
   00380 Tryptophan metabolism
    LA61_07320
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA61_07320
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA61_07320
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LA61_07320
Enzymes [BR:maz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA61_07320
Exosome [BR:maz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA61_07320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: AIR32652
Position
1456204..1457391
Genome map
AA seq 395 aa AA seqDB search
MAATNRSVIVAGARTPVGRFQGSLKDFSGAQLGGIAIAGALAKAGVAPSAVDYVIMGQVL
TAGAGQMPARQAAVAGGIGMDVPALTINKVCLSGVDAIALADQLIRAGEFEVVVAGGQES
MTNAPHLLPKSRAGFKYGDVTLIDHMAFDGLHDAFTDQAMGLLTEQRNASDKFTREEQDE
FAARSHQNAARGWKDGAFADEVVPVRIPQRKGDPIEFAEDEGIRADTTAASLAGLRPAFS
KDGTITAGSSSPISDGACAVVVMSKERAEREGLEWLAEIGAHGVVAGPDSSLQLQPANAI
RKACEREGISPEQLDLVEINEAFALVGLASIKDLGIDPEKVNVNGGAIAIGHPIGMSGAR
ITLHLAQELKRRGGGIGVAALCGGGGQGDALIVRV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacaaataggtccgtaatagttgctggagcacgtacgccggttggccggttc
cagggatccctgaaggacttttccggtgcccagctcggtggcatcgccatcgcgggcgcc
ctggcgaaggcgggcgtggccccgagcgcagtggattacgtgatcatggggcaggtgctc
accgccggtgcggggcagatgcctgcacgtcaggcggcggttgccggtgggatcggcatg
gacgtcccggcgctcaccatcaacaaggtgtgcctttccggtgtggatgccatcgccctt
gctgaccagctgattcgggccggcgagttcgaggtggtggtcgccggtgggcaggaatcc
atgaccaacgcaccccacctgctgcccaagagccgcgcggggttcaagtatggggacgtg
acgcttatcgatcacatggcgttcgacggcctgcatgacgcgttcaccgatcaggccatg
ggcttgctgaccgagcagcgcaacgcctccgacaaattcacccgtgaggagcaggacgaa
ttcgcggctcgttcgcatcagaatgcggcccgcggatggaaggacggcgccttcgccgac
gaggtggtcccggtgcggattccgcagcgcaagggcgatccgatcgagttcgccgaggat
gagggcatccgggccgacaccacggctgcctcgctggccgggctgcgtccggcgttcagc
aaggacgggaccatcactgccgggtcgtcgtcgccgatctccgacggtgcctgcgccgtc
gtcgtgatgagcaaagagcgcgcggagcgcgaggggctggaatggctcgccgagatcggc
gcgcacggtgttgtcgccggccccgactccagcctgcagctgcagcccgccaacgctatt
cgcaaggcatgcgagcgggaagggatttcgccggagcagcttgacctggtggagatcaac
gaggctttcgcgctggtgggcctggcctcgatcaaggacttgggcattgatccggaaaag
gtcaatgtcaacggtggtgcgatcgcgatcggtcaccccatcggaatgtcgggtgcccgg
atcacgctgcatctggcgcaagagctcaagcgccgtggcggcggcatcggcgtggcggcc
ttgtgtggcggcggtggtcagggtgatgccctgatcgtccgggtgtga

DBGET integrated database retrieval system