KEGG   Methanosarcina barkeri Fusaro: Mbar_A0784Help
Entry
Mbar_A0784        CDS       T00271                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00010  Glycolysis / Gluconeogenesis
mba00071  Fatty acid degradation
mba00350  Tyrosine metabolism
mba00625  Chloroalkane and chloroalkene degradation
mba00626  Naphthalene degradation
mba01100  Metabolic pathways
mba01110  Biosynthesis of secondary metabolites
mba01120  Microbial metabolism in diverse environments
mba01130  Biosynthesis of antibiotics
mba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A0784
  Lipid metabolism
   00071 Fatty acid degradation
    Mbar_A0784
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mbar_A0784
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mbar_A0784
   00626 Naphthalene degradation
    Mbar_A0784
Enzymes [BR:mba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mbar_A0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AAZ69761
UniProt: Q46ED1
Position
1:complement(945418..946350)
Genome map
AA seq 310 aa AA seqDB search
MYVPTRTLFGAGQLNNLHTQKMPGKKAMIVISNGKSARENGYLARTEKQLKLVGIETVVF
DKVQPNPLKSTVIAGAAFAKEHGCDFIVALGGGSCMDAVKAIAIMATNDGDYWDYVFGGT
GRGKQMEHKPLSVITITTTAGTGSETDPWAVVTHEENHEKIGYGSDYLFPVLAVVDPELM
ISVPPEFTAYQGFDALFHSIEGYVSNGVNLMSDMYAITAIENISKNLAKAVKNGNDLDAR
EKVAFGNTLSGVVECVGSCTSQHSLEHAMSAYHQELPQGAGLIMLSKAYFTHLIEKHVCD
NRFVQMAQIT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtacctactcgaactttgtttggagcaggtcaattaaacaatctgcatacccag
aaaatgcctggcaagaaagctatgatcgttatctctaacggaaaatccgcaagagaaaac
ggttatcttgcaagaactgaaaagcagttgaaattagtaggaatagaaaccgtagtgttt
gacaaagttcaacccaatccattgaaatcaacggtgatagcaggcgctgctttcgcaaag
gaacatggctgcgattttattgttgctctgggtggcggaagctgtatggatgcggtaaaa
gctatcgctattatggccacaaatgatggagactattgggattatgtgtttggtggaacg
ggaagagggaagcaaatggaacataaaccactctctgttataaccattacgacaacagca
ggaacaggctccgaaactgatccttgggcagttgtaacacatgaagaaaatcacgaaaag
attggatatggtagtgactacctgtttcctgttctggcagtggtcgatcctgaacttatg
atatctgtaccacccgaatttactgcctatcagggatttgatgcattattccacagcatt
gaaggatacgtttctaacggtgtcaatcttatgagcgatatgtatgccatcactgcaata
gaaaatatctcaaaaaatcttgcaaaagcagtgaagaatggaaacgatctggatgcgcgt
gaaaaagtggcttttgggaataccctttctggtgtggttgagtgtgtagggagttgcaca
agtcagcattccctagaacatgcaatgtcagcctatcatcaggaacttccccaaggtgca
ggtcttatcatgctcagcaaggcttattttacacatctgatcgagaaacatgtatgtgat
aataggttcgtacaaatggcacagataacgtga

DBGET integrated database retrieval system