KEGG   Methanosarcina barkeri Fusaro: Mbar_A1121Help
Entry
Mbar_A1121        CDS       T00271                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00040  Pentose and glucuronate interconversions
mba00052  Galactose metabolism
mba00500  Starch and sucrose metabolism
mba00520  Amino sugar and nucleotide sugar metabolism
mba01100  Metabolic pathways
mba01130  Biosynthesis of antibiotics
Module
mba_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mbar_A1121
   00052 Galactose metabolism
    Mbar_A1121
   00500 Starch and sucrose metabolism
    Mbar_A1121
   00520 Amino sugar and nucleotide sugar metabolism
    Mbar_A1121
Enzymes [BR:mba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mbar_A1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr IspD Glycos_transf_2 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAZ70089
UniProt: Q46DF3
Position
1:complement(1378011..1378898)
Genome map
AA seq 295 aa AA seqDB search
MTVKKALIPAAGLGTRFLPATKSMPKEMLPIIDTPVIQYVVEEAIASGIEDIIIITGRGK
RAIEDYFDDSPELEMHLAKKHNTELLKLVRNVSSLVDIHYIRQKEPNGLGDAVLRAENHI
GDEPFAVLLGDDIIVNNKPCTAQLIDNFEKYGRSTLAVEEVPREKLSSYGIIKGKPLSNS
LYVLEDIVEKPSPENAPSNMGAIGRYVFTPEIFDCIKEAGTGVGNEIQLTDGIRVLNRSQ
MIYACRFKGKRFDTGDRLGYVKSIVDFALENENLREDVLEYLREILAEVKEPSSK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgttaaaaaagcacttattccggcagctggtcttgggacccgtttccttcctgcc
accaagtcaatgccaaaagagatgcttcctattattgacacacctgtgattcaatatgtt
gtagaggaagccattgcctcgggaattgaggatataatcattatcacaggcaggggtaaa
cgggcaattgaagattatttcgatgattctcctgaactcgaaatgcatcttgcgaaaaag
cacaataccgaacttcttaaacttgtcaggaatgtttcttcccttgtggatattcactat
atccgccagaaagaacctaacgggctcggggatgcagttctcagggcagaaaaccacatt
ggagacgaacctttcgccgtgcttcttggagacgatattattgtgaataacaagccctgc
actgcccaactcatagataattttgagaaatatgggaggtccacgcttgcagtggaagaa
gtccctcgtgaaaaattaagtagttatggaattataaagggcaagcctcttagtaattct
ctctatgtactggaggacattgttgaaaaaccgtcacctgaaaatgctccctcaaatatg
ggagcaataggccgctatgttttcacccctgaaatatttgactgtataaaagaagccggg
acaggggtaggaaacgaaatccagttgactgatgggattcgggttcttaacaggtcacag
atgatatacgcatgcaggttcaaaggaaaaagattcgatactggcgacaggttagggtac
gtgaaatcaatagtagattttgcccttgaaaacgaaaaccttagagaagacgtacttgag
tacttaagagaaatcctagcagaggtaaaggaaccttcaagcaaataa

DBGET integrated database retrieval system