KEGG   Methanosarcina barkeri Fusaro: Mbar_A1261Help
Entry
Mbar_A1261        CDS       T00271                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit D
  KO
K00580  tetrahydromethanopterin S-methyltransferase subunit D [EC:2.1.1.86]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00680  Methane metabolism
mba01100  Metabolic pathways
mba01120  Microbial metabolism in diverse environments
mba01200  Carbon metabolism
Module
mba_M00357  Methanogenesis, acetate => methane
mba_M00567  Methanogenesis, CO2 => methane
mba_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mba00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mbar_A1261
Enzymes [BR:mba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mbar_A1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrD Pilin_N
Motif
Other DBs
NCBI-ProteinID: AAZ70224
UniProt: Q9Y8K1
Position
1:complement(1564816..1565568)
Genome map
AA seq 250 aa AA seqDB search
MIDAILGNIIWMALITIGGVLISWSVHFVPVGGAPAAMAQATGIGTGTVQLAAGAGLTGL
VSAGFMMNVTDNLPLILASGSVGAMIMIAVTMIVGSIVYVYGVGVVPSSAKVKVDPITKY
RQDLYVSQGTEGHGLPTVSYVSGIIGGGLGGIGGSLVYYSLIEVGMSAGLEAVGVTNSVT
GHELVAVAAIFAIGIFFVNAVIPSYNIGGTIEGFHDPKFKKWPKAVVSSLVASIMCAIVA
VVAIAQLGGI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgctatcttaggaaatatcatctggatggctcttatcacaataggcggcgtt
ttgatttcctggagtgtccacttcgtgcctgtgggcggtgcacctgcagctatggctcag
gcaactggtattggtaccggtacagtgcagctggcagcaggtgccggtctgacagggctt
gttagtgcaggctttatgatgaacgtaacagataaccttccgctgattctcgcatcaggc
tcagtgggagcaatgatcatgatcgctgtgaccatgattgtcggtagcattgtctacgtc
tatggtgtgggtgttgtaccttcttccgcaaaagtaaaggttgacccaattacaaagtac
aggcaggacctttatgtatctcagggtactgaagggcacgggcttccgacagtaagttat
gtgagtggaattataggcggtggccttggtggaataggagggtcccttgtttactattca
ctcatagaagtgggcatgagtgcaggcctggaagcggtcggagttaccaattcagtcaca
ggacatgagcttgtagcagttgcagcaatatttgcaataggcattttcttcgtgaacgct
gtaattccatcctataacataggaggtacaattgaagggttccacgatccaaaattcaaa
aaatggccaaaagcggtagtttcttctctcgtagcatcaataatgtgtgctatcgtggcg
gtagttgcaatcgcacagctcggaggtatttaa

DBGET integrated database retrieval system