KEGG   Methanosarcina barkeri Fusaro: Mbar_A1586Help
Entry
Mbar_A1586        CDS       T00271                                 

Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00020  Citrate cycle (TCA cycle)
mba00620  Pyruvate metabolism
mba00720  Carbon fixation pathways in prokaryotes
mba01100  Metabolic pathways
mba01120  Microbial metabolism in diverse environments
mba01200  Carbon metabolism
mba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mbar_A1586
   00620 Pyruvate metabolism
    Mbar_A1586
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mbar_A1586
Enzymes [BR:mba01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Mbar_A1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: AAZ70533
UniProt: Q46C59
Position
1:1954402..1956123
Genome map
AA seq 573 aa AA seqDB search
MSVKITETILRDAHQSLLATRMRTRDMLEVVEQLDQIGYFSLEMWGGATFDSCIRYLNED
PWQRLRDIKKEMKDTYAQMLLRGQNLVGYRHYSDDVVEKFVTKSYQNGIDIFRIFDAVND
VRNMEFSIKVAKGLGAHVQGTVCYTISPVHTVEKYVELAKQLEELECDSICIKDMAGLLS
PNDATRIISAMKKEISIPISLHCHCTSGMAPMSYMAACEAGVDILDTALSPLAWGTSQPP
TETVIAALKDTPYDTGLDLNAFEGVVKYFKMLKEKYRGILDPISEQIDTNVLIYQIPGGM
LSNLVSQLKEQNALDKYDTVLGEMPRVREELGYPPLVTPTSQIVGTQAVLNVLMGERYKV
IPKEVKDYVRGLYGRPPAPISPEIIGKIIGDEEPIHCRPADLLKPEYEKRKKEAEEMGIA
KSEEDILTYILYPAIAPKFLKGEMEEESLAVVAPVPEVQQEHKVPTHFKVEVDEEIYEVR
IEPLGGEVSISEASPKKSSAKSVKGAVCVSMQGMVLSLKVKVEDTVAEGDTIAVIEAMKM
ENAVHASHSGVVREIFVSEGDTVSPGDIIMSIE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaaaattaccgaaaccatcctccgggatgcacatcaatctctactggcaacc
agaatgcggacaagagatatgctcgaagtggttgaacaactggaccagatagggtatttt
tcccttgaaatgtggggaggtgccacctttgacagctgtatccgctaccttaatgaagat
ccctggcagcgcctgagggatatcaaaaaagaaatgaaagacacctacgctcagatgttg
ctaaggggccagaaccttgtaggttacaggcactattcggatgatgtggttgagaaattc
gttactaagtcttaccaaaacggaattgacattttccggatttttgatgctgttaatgat
gtccggaacatggaattctctatcaaagtggcaaaaggtcttggtgcgcacgtacagggt
acggtttgctacactataagtccggtacataccgttgagaaatacgttgaacttgcaaaa
cagcttgaagaactggagtgcgattccatctgtatcaaagatatggcaggtcttctttct
ccaaatgatgccacacgtataatcagtgccatgaaaaaagaaatctccattccgatttct
ctgcactgccactgcacttctggaatggctccaatgagctatatggcagcctgtgaagca
ggggtcgatattctagacactgcactttctcccctggcctggggaacttctcagcctccg
actgaaacagtcatagccgccctcaaagacactccttacgataccgggctggacctgaat
gcttttgaaggagtggttaaatatttcaaaatgttgaaagagaaataccggggcatactt
gaccctatttccgaacagatcgatactaacgtgctcatctaccagatcccgggtggaatg
ctctctaaccttgtatcccaactaaaagaacagaacgctcttgacaagtatgatactgta
cttggtgaaatgcccagggttagagaggagcttggatatccgcctcttgtcacccctaca
agccagattgtgggcacccaggcggttcttaacgttctaatgggtgaacgctataaagtt
attcccaaagaggtgaaggattatgtgcgcggcctttacgggcgccctcctgctcctata
agcccggaaataataggtaagataatcggggatgaagaacctattcactgccgtcctgcc
gatcttcttaagcctgaatatgagaaaaggaaaaaggaagccgaggaaatgggtattgct
aaatctgaagaagacatacttacctatatcctctatccggctattgctccaaagttcctg
aaaggagaaatggaagaagaatctcttgcagtagttgcccctgtccctgaagtgcagcag
gaacacaaagttccaactcatttcaaggtcgaagtagacgaagaaatctatgaggtcagg
attgaacctcttggtggggaagtttccatatctgaggcttctcccaaaaaatcaagtgct
aaatctgtaaaaggagctgtgtgtgtctcaatgcagggcatggttctctctcttaaggtc
aaggttgaagatactgttgcagaaggcgatacaatcgctgtcatcgaagctatgaaaatg
gaaaatgctgttcatgcttctcattcaggtgttgtaagagagatttttgtttccgaaggg
gacactgtatcccctggtgacataatcatgtcaatcgaataa

DBGET integrated database retrieval system