KEGG   Methanosarcina barkeri Fusaro: Mbar_A2910
Entry
Mbar_A2910        CDS       T00271                                 

Name
(GenBank) transport protein
Organism
mba  Methanosarcina barkeri Fusaro
SSDB
Motif
Pfam: MFS_1 MFS_1_like Sugar_tr
Other DBs
NCBI-ProteinID: AAZ71806
UniProt: Q467Y6
Position
1:3725926..3727224
AA seq 432 aa
MKKYLSLNSKFIFNATISAVAGYRTKLNSFSRNACLFLGYIFLISLSLGIYEVIFNLYIL
RLGFREDFLGLMLSLVSVSTGLFAIPAAMFCDKAGRKNTLLLSCLLLMFSFAVLYTTTST
FLLAFFSILYGVSSSLKIVTASTFMVENSTSYERMHLFSMYYLLYTIGVMIGNFAGGILP
QTFTSSLKIDPTDPAAYQLSLYASLAAVLISLLPLIFIKNKKSSLPEKTALLSTFFSTLR
SKTIRKLILVNGLIGMGWGLALPYFNVYFDIVLGASSRQIGFIFSLSQVVMMFTLLFVPI
LTERLGKVKVVALVQLSSIPFLLLFTSTSLLTIAAFGYIMRSAIMNMSNPVLSNFNMEVV
SEEQRATVNSLIWMSCYTCVGLSTYAGGLMMAHNYYRLPFLLTCVLYVVATVLYYVFFEK
MEKEQKNLEVSI
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaaaaaatacttatcacttaacagcaagtttatttttaacgcaaccatcagtgcggtt
gccggatacaggacaaaattaaatagtttcagtcgaaatgcgtgcctgttcttaggatat
attttcctcatctctttgagcctgggaatctacgaagtgatcttcaatctttacatctta
aggctcgggttcagagaggactttctgggactcatgctctcacttgtttccgtatccact
ggcctgtttgcaatccctgcggccatgttctgcgacaaggcaggcagaaagaacacattg
ttattgtcctgcttgcttctcatgttttcctttgcagtcctgtacaccactacctcaaca
ttcctgctggctttttttagcattctttatggagtatcttcatcgcttaaaatagttaca
gcatctacgttcatggttgaaaattctactagttatgaaagaatgcacttgttttcgatg
tactacctgttatacaccataggtgtcatgataggaaactttgcgggcggtattcttccg
cagaccttcactagctcactcaaaatcgatcccacagatccagcagcttatcagctctca
ctatatgcatctttagctgctgtgttaatttccctgttacccctgatattcataaagaac
aaaaaatcctccctgccggaaaagacagctctgctttctacttttttttcgactttaagg
tcaaaaactatccgaaaattaattctggtaaatgggcttataggtatgggatgggggctg
gctcttccctattttaatgtttatttcgacattgtccttggagcaagttccaggcagata
ggtttcatcttttccctttcccaggtggtcatgatgttcactttattatttgttcctata
cttactgaaaggttagggaaagtgaaggttgtagccctggttcagctctcctcaattcca
tttcttctgcttttcacatctacatccctacttacaatagctgccttcggatacatcatg
aggtcagctataatgaatatgtcaaaccctgtattgagcaatttcaatatggaggttgtc
agcgaagaacagagggcgaccgtgaatagcttgatatggatgagctgttatacgtgtgtt
ggactaagcacctatgcaggtggtttgatgatggctcacaactactatcgccttcctttc
cttctgacctgtgttttatatgtagttgctactgtactttattacgttttctttgagaaa
atggaaaaagagcaaaaaaatttagaggtatcaatctaa

DBGET integrated database retrieval system