KEGG   Methanosarcina barkeri Fusaro: Mbar_A2961Help
Entry
Mbar_A2961        CDS       T00271                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mba  Methanosarcina barkeri Fusaro
Pathway
mba00010  Glycolysis / Gluconeogenesis
mba00260  Glycine, serine and threonine metabolism
mba00680  Methane metabolism
mba01100  Metabolic pathways
mba01110  Biosynthesis of secondary metabolites
mba01120  Microbial metabolism in diverse environments
mba01130  Biosynthesis of antibiotics
mba01200  Carbon metabolism
mba01230  Biosynthesis of amino acids
Module
mba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mba_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbar_A2961
  Energy metabolism
   00680 Methane metabolism
    Mbar_A2961
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mbar_A2961
Enzymes [BR:mba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Mbar_A2961
Membrane trafficking [BR:mba04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mbar_A2961
Exosome [BR:mba04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Mbar_A2961
  Exosomal proteins of melanoma cells
   Mbar_A2961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4110
Motif
Other DBs
NCBI-ProteinID: AAZ71856
UniProt: Q467T6
Position
1:3809811..3810527
Genome map
AA seq 238 aa AA seqDB search
MGHLILVRHGEPGLKPEERLAGWVDISLSRKGIEEALQCAAELEKFELDLAFASNLVRTQ
ETLFLILSGQKKTGVVVHESTGKKGNPGKTDWYSYPEKLGKKLIPIYFTPYLNERYYGKL
QGRKKQKMEEKYGAEKLASWRWNFQPGPPEGESLKVVYERAVPYFKEKILPAVKAGKNVL
ICAHQGSLRALVKYIEEISDEDIKEVKFSTGELAIYRYSEGKLIRENAEMSSEIKRNL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggtcatcttatacttgtcaggcatggagaacctggattaaagccagaagaaaggctt
gccggctgggtggatatttctctcagcaggaaaggaatcgaagaggctcttcagtgtgca
gcagagcttgaaaagttcgaactggaccttgcttttgcctcaaaccttgtgcggacgcag
gaaacacttttcttaatattgtccgggcagaagaaaacaggggttgttgtccatgaaagt
acagggaagaaaggaaatccagggaaaacggactggtactcgtatcctgaaaagctcggt
aaaaaacttatcccgatttatttcacaccttatttaaacgagcgctactacggtaagctt
cagggcaggaaaaaacagaaaatggaagaaaaatacggagccgaaaaacttgcctcctgg
aggtggaactttcagccaggcccacctgaaggagaaagtctcaaagtcgtgtatgaacgt
gcagtaccttatttcaaagagaaaatcctgcctgccgtaaaggcaggaaaaaacgtgctg
atctgtgcccaccagggcagtctgagagctctggtcaaatatatagaagagatttccgac
gaggatatcaaggaagtcaaattttccacaggcgaacttgcgatatatcggtattcagaa
ggcaagctaatccgagaaaacgccgagatgagctctgagattaaaaggaacctctaa

DBGET integrated database retrieval system