KEGG   Candidatus Methylopumilus turicensis: BN1209_0819Help
Entry
BN1209_0819       CDS       T03844                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mbac  Candidatus Methylopumilus turicensis
Pathway
mbac00480  Glutathione metabolism
mbac00590  Arachidonic acid metabolism
mbac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbac00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BN1209_0819
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN1209_0819
Enzymes [BR:mbac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BN1209_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CEN55862
UniProt: A0A0B7IZL5
Position
1:801247..801777
Genome map
AA seq 176 aa AA seqDB search
MIKYFIGVVVMSLSSAAFAACPDLYNHQFTTLQGNKINLCDYQDKPILVVNTASKCGFTP
QFETLEGLYKRYQSKGLLVVGFPSNDFRQELASDKEVGDFCINTYSVKFPMITKTSVTGP
NANPLHKQLIAITKQSPMWNFYKYVILPGGKQVYAFSSEVDPASEEVMGKIKPFLK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatactttataggggtcgtcgtcatgagtttatctagcgcggcatttgcagcg
tgtcctgacttatacaatcatcagtttacaaccctgcaaggcaacaagataaatctatgt
gattatcaagacaagccgattcttgtagtcaatacagcaagtaaatgcggctttacaccc
caatttgaaacgctagaaggactttataaacgttatcaatcaaaaggcttgttggttgtg
ggatttccatctaacgactttaggcaagagctagccagtgacaaagaagtaggtgatttc
tgtatcaatacttattcggttaaattcccgatgattacgaaaacttcggtgaccggtcca
aatgccaatccacttcataagcaattgattgcaattacaaagcagtcacccatgtggaat
ttctacaaatatgtcattctgccgggtggaaagcaagtttacgcatttagtagtgaggta
gatcccgcatctgaagaagtaatgggtaaaatcaaaccattcctaaagtaa

DBGET integrated database retrieval system