KEGG   Moraxellaceae bacterium HYN0046: HYN46_02915Help
Entry
HYN46_02915       CDS       T05575                                 

Definition
(GenBank) gamma-glutamyltransferase family protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00430  Taurine and hypotaurine metabolism
mbah00460  Cyanoamino acid metabolism
mbah00480  Glutathione metabolism
mbah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HYN46_02915
   00460 Cyanoamino acid metabolism
    HYN46_02915
   00480 Glutathione metabolism
    HYN46_02915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mbah01002]
    HYN46_02915
Enzymes [BR:mbah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     HYN46_02915
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     HYN46_02915
Peptidases and inhibitors [BR:mbah01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   HYN46_02915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AXI04486
UniProt: A0A345PB27
Position
complement(649277..650827)
Genome map
AA seq 516 aa AA seqDB search
MVTSPHTLASAAGLEVLKAGGNAIEAAIAVATALSVTYPHFNGLGGDAFWVISDQSGAVQ
TISGIGQAAVQLPDFSGAIPQRGARSALTTAAAVDSWDQAYQISKTQWRGQQSWPSLFNR
AIEYASVGFPVTESQHFWQRLRGNVLRDLSGFSETFAPGGGLLSIGEHFAQPQLARSLEC
IAQYGAREFYEGDLAADIASGLEQAGSPIRLADLVHTHARVESPLRVAYRDGELVSLRPP
TQGVTTLQIMGILDRFDMSTIAEGSADYYHLLVEAVKCAFRDRDRLVCDPDYKSVPIDHM
LSSAVLDAHAQSIHLQHARAWPEVFKHGDTAFIGVCDQEGRCVSLLQTIYFDWGSGIVAG
DTGILWHNRGASFSTDPLHHNALQSGKRPFHTLNPGMYLKEGRPHLLFGTQGADGQPQTL
AAILTRLIDYQMDPYTALARPRFLLGKTFSDTRDALKLEEDAGRSVFAELTARGHEVSAI
PAQSQLAGHPGVIRIDADHTLTGAHDPRSNGLAIGL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtcaccagtccacatacattggcaagcgctgcaggccttgaagtactcaaagcaggt
ggcaatgcgattgaagccgcaatcgctgttgctacagcactcagcgtgacctatccccac
tttaatggtttaggtggcgatgcgttttgggtcattagtgaccagtccggtgcagttcaa
accatatcagggattggacaagccgcagtgcaattgcctgatttctctggggcgattccc
caacgcggtgccagatcagctttaaccacagccgcagctgtcgatagctgggatcaggcc
tatcaaatcagcaagacgcagtggcgcggccagcaatcatggccgtcactttttaatcgt
gccattgagtatgcgtcggtgggttttcccgtaactgagtctcagcatttctggcagaga
ctgcggggcaacgtattacgtgatttatccggtttttcagaaacttttgcaccaggcggc
ggtctattaagcataggcgagcactttgctcagcctcaattagcgagaagtcttgagtgc
attgctcaatatggagcccgggaattttatgaaggcgaccttgcagcggatattgcatcg
ggactagagcaagcaggctcccccatcagattggctgatctggtccatacccacgctcga
gtcgagtcccccttacgtgttgcttatcgtgatggagagctcgtgagtttgcgcccaccc
acgcaaggggtcactacactacagatcatgggcattttggaccgattcgacatgagtacc
attgccgaaggcagtgccgactactaccacttgcttgtggaagcggtgaaatgtgcgttt
cgtgatcgagaccgtctggtctgtgaccctgactataaatcagtgccgattgatcacatg
ctgtcttctgccgttcttgatgcccatgcacaatctattcacttacagcatgcacgcgct
tggccagaagtgtttaaacatggcgacactgcttttattggggtctgcgatcaagaaggc
cgctgtgtcagcttactgcaaaccatttattttgactgggggagcggcatcgttgctgga
gatacaggaattctttggcacaatcgcggcgcatcatttagcaccgaccctctgcatcat
aatgccctgcaatctggtaaacgaccatttcatacattaaatccgggcatgtatctcaaa
gaaggtcgcccgcatctgctgtttgggacacaaggtgcggatggccagccacaaacacta
gctgcaatcctgacccgactcattgattatcagatggatccttataccgcgctcgctcgt
ccacgttttttgctgggcaagaccttctctgacacccgagatgcactcaagctagaagaa
gatgctggccgtagcgtatttgctgagttgactgcacgcggccatgaagtcagtgcgatc
ccggcacaaagccaactcgcaggccatccgggtgtcattcggattgacgcagaccataca
ctgacaggtgcacacgacccacgcagcaacggcctggcgattggcttatga

DBGET integrated database retrieval system