KEGG   Moraxellaceae bacterium HYN0046: HYN46_04170Help
Entry
HYN46_04170       CDS       T05575                                 

Definition
(GenBank) HAD family phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00010  Glycolysis / Gluconeogenesis
mbah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYN46_04170
Enzymes [BR:mbah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     HYN46_04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Acid_PPase Hydrolase RloB
Motif
Other DBs
NCBI-ProteinID: AXI02123
UniProt: A0A345P4B4
Position
complement(942149..942754)
Genome map
AA seq 201 aa AA seqDB search
MSTVKALLFDLGGVVIDISFVSAFQHWSALSPLSLENMQDRFQFDEVFQHFERGEIGEPT
YFERLRKQLQLTGSDDQIKQGWNAIIRGQISETLAVVQQARQKLPCFAFSNTNETHITLL
DRDYSDVLNTFDHVFLSSRIGMRKPEQAAFEFIAQSIDVPVHEILFFDDLAENVNGAKRA
GLQTVLVQNPNDVRQALSAFI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggttaaagccctacttttcgatctcggcggtgtcgtcatcgacatcagcttt
gtcagtgcgtttcagcattggagcgcactctccccgcttagcttagaaaacatgcaagac
cgctttcaatttgacgaggtctttcagcatttcgaacgtggtgagattggtgaacccacg
tattttgagcgtttacgcaagcagcttcaattgacaggcagtgatgatcaaattaaacaa
ggttggaatgcgattatcagagggcagatcagtgaaacgttagcagtggtgcagcaagct
cgtcaaaagctcccatgctttgcattttcgaataccaacgaaacgcacatcactcttctg
gatagggactactcagacgtactaaacacgtttgatcacgtcttcctgtcatcacgaatc
ggtatgcgtaaacctgaacaagctgcgttcgaattcattgcacaatccattgatgtgccc
gtacatgagattcttttttttgacgatctcgcagaaaacgtcaatggcgctaagcgtgcg
gggttgcaaaccgtgttggttcaaaatccaaatgatgtgcgccaagcactctcagcattt
atttaa

DBGET integrated database retrieval system