KEGG   Moraxellaceae bacterium HYN0046: HYN46_10510Help
Entry
HYN46_10510       CDS       T05575                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HYN46_10510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mbah03011]
    HYN46_10510
Ribosome [BR:mbah03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HYN46_10510
  Bacteria
    HYN46_10510
  Archaea
    HYN46_10510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXI03233
UniProt: A0A345P7H4
Position
complement(2334402..2334734)
Genome map
AA seq 110 aa AA seqDB search
MTEVTAILRGAAISAQKVRLVADLVRGKPVGRALDILTYSNKKAAVLVKKALQSAIANAE
HNNSMDVDALKVATIYVDEGVTLKRISPRAKGRADRISKRTCHITVKVGV
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagtaactgccatattgcgcggtgcagccatctcggcacagaaagttcgcttg
gtcgcagacctcgtgcgcggaaagccggttggacgtgctctagatattctgacttacagc
aacaaaaaagctgctgtattagttaaaaaagctttgcaatcggctattgccaatgcagag
cacaacaatagtatggatgtggatgctcttaaagtcgccacgatctatgttgatgaaggt
gttacgttgaaacgtatctctccacgtgcgaaaggccgtgcagatcgtatcagtaaacgt
acatgccacatcactgtcaaggtaggggtttga

DBGET integrated database retrieval system