KEGG   Moraxellaceae bacterium HYN0046: HYN46_11385Help
Entry
HYN46_11385       CDS       T05575                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HYN46_11385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mbah02022]
    HYN46_11385
Two-component system [BR:mbah02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   HYN46_11385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C SH3_18
Motif
Other DBs
NCBI-ProteinID: AXI03390
UniProt: A0A345P7Y1
Position
2529022..2529777
Genome map
AA seq 251 aa AA seqDB search
MSLVVPADEAPRGTTTGERILVVDDDARLRALLQRFLEDKGFVVRTAHDAPQMDRLMQRE
LFSLIVLDFMLPIEDGVSICKRLRSNNINTPIVMLTARGSDSDRIAGLEAGADDYLPKPF
NPNELLARIRAVLRRQVREVPGAPSQLMTVINFGSWSLDLSTRSLTRNGEVVTLTTGEFA
VLKALVQHPREPLTRDKLMNLARGREWGAMERSIDVQVSRLRRLIEENPARARYIQTVWG
VGYVFVPDGAE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagtagtacctgctgatgaagcaccccgcggcaccacaaccggtgagcgtatt
ttggtggtggatgatgacgctcgtctacgtgcattgctacagcgctttctcgaagacaag
ggatttgtcgttcgcactgcccatgacgcaccgcaaatggatcgtctcatgcaacgtgaa
ttattttcactgattgtattagactttatgctgcccattgaagatggcgtcagcatctgt
aagcgtttgcgcagcaataatatcaacacgcctatcgtcatgctcactgcacgcggtagt
gactctgaccgtattgcaggtcttgaggctggcgcagatgactatttgcccaaacccttt
aacccaaatgaacttttagcacgcatccgtgcagttctgcgccgccaagtccgcgaagtg
cccggcgcccctagccaactgatgactgtcattaactttggctcatggtctttggattta
tctacacgctcactcacccgcaacggcgaagtcgtcacgctcacgaccggtgaatttgcc
gtattgaaggcactcgtacagcatccacgggaacccttaacacgcgataagctgatgaac
cttgcgcgtggacgtgagtggggtgcaatggagcggtccattgacgtacaggtctcgcga
ctgcgacgtttgattgaagaaaatcccgcacgtgcacgctatatccaaaccgtatggggt
gtcggctatgtatttgtacccgatggtgccgaataa

DBGET integrated database retrieval system