KEGG   Moraxellaceae bacterium HYN0046: HYN46_13840Help
Entry
HYN46_13840       CDS       T05575                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00562  Inositol phosphate metabolism
mbah00564  Glycerophospholipid metabolism
mbah00565  Ether lipid metabolism
mbah01100  Metabolic pathways
mbah01110  Biosynthesis of secondary metabolites
mbah02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    HYN46_13840
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HYN46_13840
   00565 Ether lipid metabolism
    HYN46_13840
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HYN46_13840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mbah02042]
    HYN46_13840
Enzymes [BR:mbah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     HYN46_13840
Bacterial toxins [BR:mbah02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   HYN46_13840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal Peptidase_S31
Motif
Other DBs
NCBI-ProteinID: AXI03820
UniProt: A0A345P961
Position
complement(3067312..3069384)
Genome map
AA seq 690 aa AA seqDB search
MTSRRNFLRMSATAAAAAGLPASIQKALALPAISKTGTINDVKHVVILMQENRGFDHYFG
TLNGVRGYGDARPTPLPSGAPVWYQPNGKGGYVLPFHLDTSKTSAQQLGDMDHSWTGTHS
AWNNGKYDGWVTTKGQNAMGYFKRADIPYHYALADAFTICDAYHCSIMASTDPNRYYLWT
GWAGNDGKGNGPVIDNSEAGNYAWTTYPERLQAANISWRVYQDPGIGLNAAGSWGWTSNP
YIGNYGDNSLLYFQKYQDAKPGSALYTNAVTGYSLADLKKDVINNTLPQVSWIAAPEAFT
EHPSWTPGYGARYISEVLDALTSNPDVWGSTVFFINYDENDGFFDHDAPPVPPASSNQGK
STVDTVNEFFAGNSKYAAGAYGLAQRVPMLAISPWSKGGWVSSEVFDHTSVIRFLEKRFG
VMEPNITPWRRSICGDLTSLFDFKNPNGQVPTLPNTSLYTQIADSQSLLPSPTVPSVQVL
PVQESGQRPTRPVPYELFVQSRQDPIQKKFWLDFANSGLSGAAFRVYAGNRSDGPWFYTV
GAGAVTSDYWTGDDYNLAVYGPNGFLRVFHGNLADTALPKRGNPDATLCYDVANGNVILT
LSNRGTVACTITVQANTYSTQRRSYTVQPGTDVQDIWDLKNSHGWYDLSVVASTANGFLR
RFAGHVEDGKNSMSDPAFGTMVSLSPMQCS
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
gtgacatctagacgcaatttcttacgcatgtcggcgactgccgccgcagcggctggactg
ccagcatccattcaaaaagcattggcactgccagcgatctccaagactggcacgatcaac
gacgtcaagcatgtcgtgatcctaatgcaagagaatcggggttttgatcattactttggt
actttaaatggcgtgcgtggctatggtgatgcgcgcccgactccactgccgagtggtgcg
ccagtctggtaccagccgaatggcaaaggcggctatgtgctgccctttcatctagacacc
agcaagaccagcgcccagcaactgggtgatatggatcatagctggactggcacccatagc
gcatggaacaacggcaagtatgatggctgggtcacgacgaaaggccaaaacgccatgggt
tatttcaagcgtgccgatattccttatcattatgcactcgccgatgcctttacgatttgt
gacgcctaccattgctctatcatggcatcgacagatcctaaccgttactatctgtggacg
ggctgggcaggcaatgatggcaaaggcaatggcccggtcatcgataactcagaagcgggt
aactacgcatggacgacctatccagagcgtctgcaagccgccaatatctcatggcgggtc
tatcaagatcccggcatcggtctaaatgccgccggtagttggggatggaccagcaatccg
tatatcggcaactatggtgataactccttactgtattttcaaaagtatcaagatgccaag
ccgggttcagcgttgtataccaatgcggtcacaggctacagcctcgctgatcttaaaaaa
gacgtgatcaataacactttgccgcaagtgtcatggatcgctgcaccggaagcctttacc
gagcatccatcgtggacgccgggctacggcgcgcgttatatctccgaagtgttggatgcc
ttaaccagtaatccagacgtgtggggcagtacggtgtttttcatcaactatgatgaaaat
gatggcttctttgatcatgatgcgccgccagttccacctgcttcgagcaatcaaggcaaa
tcgactgtggatacggtgaatgaattttttgccggaaacagtaaatatgccgcaggcgct
tatgggctggcgcagcgcgtgccgatgctggcaatatcaccgtggtctaagggcggctgg
gtctcttcagaagtgtttgaccacacttctgttatccgattccttgaaaaacggtttggc
gtgatggaacctaatatcaccccttggcgccgcagcatttgtggtgatttaacctcattg
tttgattttaaaaatcccaatggacaggtgcccacactccccaataccagtctctacact
caaattgccgacagccagtctctattgccaagccctactgtaccatcggtgcaagtctta
cccgtccaagagtcgggccagcgtcccacacgtccagtcccctatgagctctttgtccaa
tcccgccaagacccgattcagaaaaagttctggctggattttgccaatagcggcttgtcg
ggtgcggcatttcgtgtctatgcgggcaatcgctctgatggtccttggttctataccgtc
ggcgcaggcgcggtgacatcggattactggacaggggacgactataatcttgcggtctat
ggccccaatggtttcttgcgtgtctttcatggcaatttagcagatactgcgttgcccaaa
cgtggcaatcctgacgccacgctttgctatgacgtcgccaatggcaatgtcatcctgacc
ttaagcaaccgcggaaccgtcgcgtgtaccatcaccgtgcaagccaatacctacagtact
cagcgccggagttataccgtccagccgggaacagatgtacaagacatctgggacctaaag
aacagtcatggttggtatgatctgtcggtggtggcatcaacggccaatggcttcttgcgt
cgttttgccggtcatgttgaagacggcaaaaacagcatgagcgatcccgccttcggaacc
atggtttcattaagtccaatgcaatgtagctaa

DBGET integrated database retrieval system