KEGG   Moraxellaceae bacterium HYN0046: HYN46_16085Help
Entry
HYN46_16085       CDS       T05575                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mbah  Moraxellaceae bacterium HYN0046
Pathway
mbah00860  Porphyrin and chlorophyll metabolism
mbah00970  Aminoacyl-tRNA biosynthesis
mbah01100  Metabolic pathways
mbah01110  Biosynthesis of secondary metabolites
mbah01120  Microbial metabolism in diverse environments
Module
mbah_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mbah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HYN46_16085
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYN46_16085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbah01007]
    HYN46_16085
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbah03016]
    HYN46_16085
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mbah02048]
    HYN46_16085
Enzymes [BR:mbah01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     HYN46_16085
Amino acid related enzymes [BR:mbah01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HYN46_16085
Transfer RNA biogenesis [BR:mbah03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HYN46_16085
 Prokaryotic type
   Other AARSs
    HYN46_16085
Prokaryotic defense system [BR:mbah02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    HYN46_16085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AXI04221
UniProt: A0A345PAB2
Position
complement(3553326..3554849)
Genome map
AA seq 507 aa AA seqDB search
MTVRTRIAPSPTGFPHVGTAYVALFNLCFARQHGGEFILRIEDTDQTRSTPESEQMILDS
LRWLGLNWTEGPDIGGKHAPYRQSERREIYTQHANILLEKGHAFNCFCSEARLTEVRNAQ
MANKETPRYDGHCLHLTAEEVSQRIAAGEPHVVRMKVPTEGICHIDDLLRGAIEIPYEQV
DMQVLLKQDGLPTYHLANVVDDHLMEITHVLRGEEWISSAPKHKLLYQYFGWDMPVLCHL
PLLRNPDKSKLSKRKNPTSITYYRDMGFLPEALLNYLGRMGWSMPDEREQFTLSEMIEHF
DIQRVSLGGPIFDVEKLTWLNGLWIRDLSPAALLDKILSWRGNRAQLEKITAAIQPRINT
LSDAADWAGFFFNGSPKATQPLTAESFAHKKLTQDQVRQVLQLSLWRLERLMQWNEETVK
ATLMTLSEQMEIKLRDFMPSFFIAIAGSSTSTPVMESMAILGADLTYARLRQAVEILGGV
SKKETSEWQKLDISLNEPKIIDEGVEK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcgtactcgtattgctccttctccgacaggctttccgcatgtaggcaccgcc
tatgtcgcgctgtttaatctgtgttttgcccgtcagcatggcggtgagttcattctacgt
attgaagacaccgaccaaacccgctccacacctgaatccgagcagatgattctggattcc
ctgcgttggctcgggttgaactggacagagggtccagatattggcggtaaacatgccccg
tatcgtcaaagcgaacgccgtgagatctatactcagcatgccaatatcttgctggaaaaa
ggccatgcatttaactgcttctgtagcgaagcgcgcctgaccgaagtgcgtaatgcacaa
atggctaataaagaaacgccacgttacgatggccattgtttgcatttgaccgctgaagaa
gtcagtcagcgcattgcagcgggtgaaccgcatgtggtgcgtatgaaggtgccgacggaa
ggtatttgccatattgatgacctgctacgcggtgcgatcgagatcccttatgagcaagtg
gatatgcaagtcctgctcaagcaagacggtttgccgacttatcacttggctaacgtggtc
gatgatcacctgatggaaatcactcatgtgctgcgcggtgaagagtggatttcctcggcc
ccgaagcacaaattgctctatcaatatttcggctgggacatgccagtgctctgtcatttg
ccactcctgcgcaatccggataaatccaaactgtctaaacgcaagaatccgaccagcatc
acctattaccgtgatatgggcttcttacctgaagccctgctcaattacttgggccgtatg
ggctggtcgatgcctgatgaacgtgagcagttcaccttgagtgagatgattgagcacttt
gatatccaacgcgtatcgttgggtgggccgatctttgatgtcgagaaattgacttggctg
aatggcctgtggattcgcgatctatcaccagcggcattgctggataaaatcctgtcatgg
cgcggtaaccgtgcgcagcttgagaagattactgccgcgatccagccacggatcaatact
ttgtcagatgctgccgattgggccggattcttctttaatggctcacccaaagcgacgcag
ccgctgacggctgagtcgtttgcacataagaagctcacccaagaccaagtccgtcaggta
ttgcaattgtcgctttggcgccttgagcgtttgatgcagtggaatgaagagactgtcaaa
gccacactcatgaccctgtctgaacagatggaaatcaaactgcgtgattttatgccatcg
ttctttattgcgattgccggtagttcgacttcgacgcctgtgatggagtcgatggcgatt
ttgggtgccgatttgacctatgcacgtctacgccaagcagttgaaattcttggaggcgtt
agcaaaaaagagacctcagagtggcaaaagctcgatatttcgctaaatgaaccaaaaatc
attgacgaaggggtcgaaaagtaa

DBGET integrated database retrieval system