KEGG   Methanosarcina barkeri 3: MSBR3_1013Help
Entry
MSBR3_1013        CDS       T04533                                 

Definition
(GenBank) Nitrogenase (vanadium-iron) beta chain
  KO
K22897  vanadium-dependent nitrogenase beta chain [EC:1.18.6.2]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00910  Nitrogen metabolism
mbak01100  Metabolic pathways
Module
mbak_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MSBR3_1013
Enzymes [BR:mbak01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.2  vanadium-dependent nitrogenase
     MSBR3_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AKB81591
UniProt: A0A0E3SJ54
Position
1366763..1368133
Genome map
AA seq 456 aa AA seqDB search
MLKERTGIINPMYTCQPAGAQFAGIGIKDCIPLVHGGQGCSMFVRLLFAQHFKENFDIAS
SSLHESAAVFGGSIRVEEAVEVLIARYPHLKIIPIITTCSTETIGDDIEGIIRKLNPKIK
EKHPDRDVKLIAVHTPSYSGSQVTGYDNAISAVVKALAKKDEPSEKLNIFTGWVNPGDVS
EIKHMLSEMQVDGNILMDTETFDAPIMPDKSAFAYGNTTIEEIADSANAIGSIALSRYEG
ANAAKYLEDKFGVPSIVTPTPIGINNTDIFLENISKLTGKPIPESLIIERGKAIDAIVDL
AHMFFANKKVAIFGNPDLVFGLAQFCLECELEPVLLLLGDDNTLYKSDPRLKVLEDKANC
DIKTIWNADLWELESRVKNKSIDVDLILGHSKGRYIAIDNDIPMVRVGFPTFDRAGLWKY
PVIGYKGAEWLAETIANTIFASMESKHDREWIINVW
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagagcgaacaggaataattaatcctatgtatacctgtcagcctgcaggtgct
caatttgcaggaattggtataaaggattgcattccgcttgtacatggcggtcagggttgc
agcatgtttgtcagactgttgttcgctcagcatttcaaagagaattttgatatagcttct
tcttctctgcacgaaagcgccgccgttttcgggggctcaataagggttgaagaggcggtt
gaagtacttattgcgagatatcctcacctgaagattatacctattataacgacctgttca
actgaaactattggtgacgatattgaaggtataatccgaaaactaaatccgaaaattaaa
gaaaagcatcctgatagagatgtgaagcttatagctgtgcatacgccaagttacagcggt
agccaggtaacaggctacgataatgcaattagcgcggttgtaaaagctcttgcaaaaaaa
gacgaaccttctgaaaagttgaacatattcacaggatgggtaaatccaggagatgtttct
gaaattaagcatatgttatctgagatgcaggttgacgggaatatacttatggataccgag
acctttgatgcccctattatgcctgacaaatcggcattcgcatacggaaatacaaccatt
gaggaaattgccgattctgccaatgctattgggtcaattgcattaagccgttatgaggga
gcaaatgctgcaaaatatctagaagataagttcggcgtgccttcaatcgttacgccaaca
cctataggcataaacaacaccgatatctttcttgaaaatatcagcaaacttaccggcaag
cccatacccgagtcactgattatcgaacgcggaaaagcgatagatgcaattgtagacctt
gctcacatgtttttcgcaaataagaaagtagccatattcgggaatccggatcttgtcttc
ggtcttgctcaattttgtctggagtgtgaacttgaacctgtgcttttacttttgggcgat
gataacacgctgtataaaagtgacccaaggctcaaagtacttgaagataaggcaaactgc
gatataaaaactatctggaacgctgatttatgggaactggaaagccgtgttaaaaacaaa
tccatagacgtcgatttgattttggggcattcaaaaggccgatacattgccatagacaat
gacattcctatggtcagggtaggcttcccaacctttgacagagcagggctttggaaatat
ccagtaatcggatacaaaggagcagaatggttagctgaaacaattgccaatacgattttt
gcatccatggaaagcaagcatgacagagaatggataattaatgtctggtaa

DBGET integrated database retrieval system