KEGG   Methanosarcina barkeri 3: MSBR3_1297Help
Entry
MSBR3_1297        CDS       T04533                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSBR3_1297
Enzymes [BR:mbak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     MSBR3_1297
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     MSBR3_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 DAO FAD_oxidored Lycopene_cycl HI0933_like NAD_binding_8 Pyr_redox_2 Trp_halogenase GIDA Thi4 Pyr_redox_3 AlaDh_PNT_C 3HCDH_N SE Pyr_redox XdhC_C
Motif
Other DBs
NCBI-ProteinID: AKB81875
UniProt: A0A0E3WVH6
Position
1761445..1762668
Genome map
AA seq 407 aa AA seqDB search
MKDTYDVLVIGAGPAGSIAARTAAEKGLDVLLIEKRQEIGDPVRCAEGVNKAYLKKHVEI
DKRWICADLNASHIYAPDGTKIEMAEEIAGGEVGYVLERKVFDRALAEQAAEAGAEVRVK
TRATGLIIEDGFVKGARLMHLGKEYDVRAKIVIGADGVESKVGRWAGIDTSLKPIDIETC
AQYLIAGANIDQHHCEFYVGNEIAPGGYIWVFPKGGGKANVGIGVLGSEAGKFKPRPVDY
LDRFLEKKFPDARIVEMVFGGVPVSGSIEKTSTNGLMLIGDAARQSDPITGGGILNAMDA
GKIAGEAAYTAISEGDVSFEKLEEIYEKPWRATLGHDIDMSLIVKNCFINLSDEDLNSLA
HSLEGMKFERMSLLDLLQALFKADKKLLWDLRVLFKDAAKEVVKSKM
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacacgtatgatgttttagtgataggtgccggtcctgcaggttccattgccgcc
agaaccgcagccgaaaaagggctggacgtactcttaatcgagaaacgccaggagataggt
gaccctgtacgctgtgccgaaggtgtgaacaaagcatatctcaagaaacacgtggaaatt
gacaaaagatggatttgcgctgaccttaatgcttctcatatctacgcgccggatggtaca
aagatagagatggcagaagaaatcgctggtggagaagtaggttacgttcttgagagaaaa
gtgtttgaccgggctcttgctgaacaggctgccgaagccggagcggaagttagagtaaaa
accagagcaactggccttatcattgaagacggttttgtcaagggagccaggctcatgcat
ctaggaaaagaatatgatgtgcgggccaagatagtaataggcgctgacggggtcgaatca
aaggtaggcagatgggcaggtatcgacacttccttaaagccaatagatatagaaacatgt
gcccaatacctgatagctggagcgaacatagaccagcaccactgtgaattttacgtaggt
aacgaaattgcaccaggcggctatatctgggtctttccgaaaggtggtggaaaagccaat
gtcggaatcggagttctcgggagtgaggctggaaaattcaagccaaggcctgtagattat
ctcgacagatttcttgaaaagaaatttcccgatgcaaggatagtcgaaatggttttcgga
ggagttccggtttcaggcagcattgaaaaaacttccactaacgggctgatgctaatcgga
gacgctgctcgccaatccgatcctattacaggcggtggaatccttaacgcaatggatgcc
ggaaagatagcaggagaagctgcatatacagctatatctgaaggagatgtttccttcgaa
aaactcgaagaaatttatgagaaaccatggagagcaaccctgggacacgacattgacatg
agccttatcgtaaagaattgctttatcaatctaagcgatgaagacctgaattcacttgcc
cattctctagaaggcatgaaatttgagagaatgagccttcttgacctgttacaggctctc
tttaaagccgataaaaaacttctctgggatcttcgagtacttttcaaagatgccgcaaaa
gaagttgtaaagagcaaaatgtaa

DBGET integrated database retrieval system