KEGG   Methanosarcina barkeri 3: MSBR3_1913Help
Entry
MSBR3_1913        CDS       T04533                                 

Definition
(GenBank) UbiX family decarboxylase associated with menaquinone via futalosine
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00130  Ubiquinone and other terpenoid-quinone biosynthesis
mbak00627  Aminobenzoate degradation
mbak01100  Metabolic pathways
mbak01110  Biosynthesis of secondary metabolites
mbak01120  Microbial metabolism in diverse environments
mbak01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    MSBR3_1913
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MSBR3_1913
Enzymes [BR:mbak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     MSBR3_1913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AKB82491
UniProt: A0A0E3SKU4
Position
complement(2577397..2577948)
Genome map
AA seq 183 aa AA seqDB search
MEIAVGISGASGVQYGIRLLEVLEEKGIKTHLVLTDAASQIIRIETDYTPEAVEKLATWS
YAQKDFSAPIASGSYRTGGMVIAPCSMKTLAAVANGVSDTLLTRAADVCLKEERKLILMT
RETPLNLIHIENMLRAKKAGASILPACPGFYSRPRTLEDLIDTMVGRTLDLLGIENEIYR
RWK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggagatagcagtaggaatcagtggagcctcaggggtccagtatggaattcgcctcctt
gaagtactggaggaaaaaggaattaaaacccatctggttttgacggatgccgcaagccag
ataataaggattgagactgattacacccccgaagcagtagaaaaacttgcaacctggagc
tatgcccagaaagatttttcagcaccaatcgctagtggttcatacaggacaggaggaatg
gttattgctccgtgcagcatgaaaactcttgcagccgtggcaaatggggtatccgatact
cttcttacaagagctgcagacgtctgcctcaaagaggaaagaaaacttatcctgatgacc
cgagaaaccccgcttaaccttatacacatcgaaaatatgctcagggctaaaaaagcagga
gcaagcatccttccagcctgccctggcttttattcacggcccagaacccttgaagacctg
atagataccatggtaggaaggacacttgacctgctcgggatagaaaacgagatttatcga
cgctggaagtaa

DBGET integrated database retrieval system