KEGG   Methanosarcina barkeri 3: MSBR3_2147Help
Entry
MSBR3_2147        CDS       T04533                                 

Definition
(GenBank) N5-methyltetrahydromethanopterin:coenzyme M methyltransferase subunit B
  KO
K00578  tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00680  Methane metabolism
mbak01100  Metabolic pathways
mbak01120  Microbial metabolism in diverse environments
mbak01200  Carbon metabolism
Module
mbak_M00357  Methanogenesis, acetate => methane
mbak_M00567  Methanogenesis, CO2 => methane
mbak_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSBR3_2147
Enzymes [BR:mbak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSBR3_2147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrB
Motif
Other DBs
NCBI-ProteinID: AKB82725
UniProt: A0A0E3WWF6
Position
complement(2879976..2880302)
Genome map
AA seq 108 aa AA seqDB search
MSMVRIAPEINLVLDPDTGTVTQERKDSIQYSMEPVFERMDKLDAVADDLLNSLSPSKPL
LSSWPGRENTSYMAGFYGNTFYGVVIGLAFSGLLALIIYISSLMKGVV
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggttagaatagctcccgagataaatttagttctggacccggacacgggaacc
gtgacacaggaacggaaagactcgattcagtactccatggaaccagtgtttgagagaatg
gacaaactggatgcagtcgcagatgatctgctgaattccctttcgcccagcaaaccactc
cttagttcctggccagggcgtgagaacacctcctatatggcaggattttacggaaacact
ttttacggagtcgttataggtcttgccttcagcgggttacttgcccttatcatatatata
tcaagtttgatgaaaggggtggtgtaa

DBGET integrated database retrieval system