KEGG   Methanosarcina barkeri 3: MSBR3_2679Help
Entry
MSBR3_2679        CDS       T04533                                 

Definition
(GenBank) Geranylgeranyl diphosphate reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mbak  Methanosarcina barkeri 3
Pathway
mbak00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mbak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSBR3_2679
Enzymes [BR:mbak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     MSBR3_2679
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     MSBR3_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO FAD_oxidored HI0933_like GIDA FAD_binding_2 Pyr_redox_2 NAD_binding_8 Thi4 Pyr_redox_3 Lycopene_cycl Trp_halogenase AlaDh_PNT_C Pyr_redox 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AKB83257
UniProt: A0A0E3SNM6
Position
3543348..3544538
Genome map
AA seq 396 aa AA seqDB search
MIPEASYDVLVVGAGPAGSTAAMYAAENGASVLLLDKKKEIGSPIQCAGFLPDALEVQAL
LHEARLPDTLKNYPESCVLQRTDTQRIITPNCNIKEFAVRGTVLDRRRYDQFLAEQAARA
GAELMVKTHVTKIEGTNVETSGAFGKHTIKAKAIIGADGPNSFVAKSKGLALKPELKETS
VALEYQVRNVDIDPSCLEMYFGKDFVPGGYAWIFPEGQDRANVGIGIRSGMAEKGISAKE
YLHRFMLDHPLAGPKLKNCIIMNVIAGIIPVNGAPEKTATENTLIVGDAAGQVFATNGGG
IPPAMIAGKVAGETAAEFAAGKCKLEEYDHRWRAQFGQALETSVQARQLMDGIMRSDTLM
NAAFKLISSEQMKVMQCGKLPGPVKLGLQALNRGKK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattcccgaagcttcttatgatgtactcgttgttggtgcaggtcctgcaggttctaca
gccgccatgtacgccgcagagaatggcgcctcggtgcttcttcttgataaaaaaaaagag
ataggaagtcctattcagtgtgctggcttccttcccgatgctttggaagtccaggccctg
ctccatgaggccaggcttccggatacactgaaaaactaccctgaatcttgtgtgctgcag
aggactgatactcagcgtattatcactccaaactgcaatataaaagagttcgctgtcagg
ggaacagtccttgaccgacgcaggtatgaccagttccttgccgagcaggcagcaagagca
ggagctgaactgatggtcaaaacccacgtaacgaaaattgagggaacaaatgttgaaaca
tcaggagcctttgggaaacatacaattaaagcaaaagcgattatcggagctgacggtccc
aattcttttgtagcaaaatcaaaaggtcttgcccttaagcccgaattaaaggaaacctcg
gttgctctcgaataccaggtcaggaatgtggatattgatccttcttgcctggaaatgtat
tttggaaaggattttgtgcctggcggctatgcatggatttttcccgaaggccaggaccgg
gcaaatgtaggaatcggaattcgaagcggtatggctgagaaagggatctctgcaaaggaa
tacctgcaccgttttatgctggatcacccgcttgcaggaccaaaactgaagaactgcata
atcatgaacgttattgcaggcattatccctgtaaatggcgctccggaaaaaactgcaact
gaaaacacgctgattgtaggggatgcagcaggccaggtttttgctacaaacggaggtgga
attcctcctgcaatgattgccggaaaagtagcaggagaaactgcagccgaatttgcagcc
ggaaaatgcaagcttgaagaatacgaccaccgctggcgggctcaattcggacaggcgctt
gagacctcggtgcaggcaagacagctcatggatgggattatgaggtctgatactctaatg
aatgcagctttcaaacttatttcttctgaacagatgaaagttatgcaatgcggaaaactc
cccggacccgtaaaacttggactccaggcgttgaaccggggaaagaagtaa

DBGET integrated database retrieval system