KEGG   Methanosarcina barkeri 227: MSBR2_1164Help
Entry
MSBR2_1164        CDS       T03914                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mbar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSBR2_1164
Enzymes [BR:mbar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     MSBR2_1164
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     MSBR2_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 FAD_oxidored DAO Lycopene_cycl HI0933_like NAD_binding_8 Pyr_redox_2 GIDA Trp_halogenase Thi4 AlaDh_PNT_C Pyr_redox_3 3HCDH_N SE XdhC_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AKB57680
UniProt: A0A0E3R282
Position
complement(1485640..1486863)
Genome map
AA seq 407 aa AA seqDB search
MKDMYDVLVIGAGPAGSIAARTAAEKGLDVLLIEKRQEIGDPVRCAEGVSKVHLKKYVEI
DKRWICSDLNASHIYAPDGTKIEMAEEIAGGEVGYVLERKVFDRALAEQAAEAGAEVMVK
TRATGLIIEDDFVRGARLMHLGKEYDVRARIVIGADGVESKVGRWAGIDTSLKPIDIETC
AQYLIAGANIDQHHCEFYIGNEIAPGGYIWVFPKGGGKANVGIGVLGSKTGKFKPRPVDY
LNRFMEKKFPDARIVEMVFGGVPVSGSIEKTSTNGLMLIGDAARQSDPITGGGILNAMNA
GKIAGEAAYAAISAGDVSLKKLEEVYEKPWRETMGHDINMSLIVKNCFINLSDEELNSLA
YSLKNVKFERMSLLDLLQALFKANKKLLWDLRVLFKDAAKEVVKNKT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacatgtatgatgttttagtgataggtgccggtcctgcaggttccattgccgcc
agaaccgcagctgaaaaagggctggatgtacttttaatcgagaaacgtcaggagataggt
gaccccgtacgctgtgccgaaggcgtgagcaaagtacatctcaaaaaatatgtggagatt
gacaagagatggatttgttctgaccttaatgcttcccatatttacgctccagacggtaca
aagatagagatggcagaagaaatcgctggtggagaagtaggttacgtccttgagagaaaa
gtgtttgaccgggctcttgcagaacaggctgccgaagccggagcggaagtgatggtaaaa
accagagcaactggtcttatcattgaagacgattttgtcagaggagccaggctcatgcat
cttggaaaagaatatgatgtgcgggccaggatagttataggtgctgacggggtcgaatca
aaggtaggcagatgggcaggcatcgatacttctttaaaaccgatagatatagagacctgt
gcccaatatctgatagctggagcgaacatagaccagcaccactgcgaattttacataggt
aatgaaattgcacctggcggttatatatgggtctttccgaaaggcggcggaaaagccaat
gtaggaatcggagttttagggagcaagactggaaaattcaagccaagacctgtagactat
cttaacaggtttatggaaaagaaatttccagatgccaggatagtcgagatggttttcgga
ggagttccggtttcaggtagcattgagaaaacttccactaacgggctgatgctaatcgga
gacgctgcccgccaatctgaccctatcacaggcggtggaattcttaacgcaatgaatgct
ggaaagattgcaggagaagctgcatatgcagctatatccgcaggagatgtttccctcaaa
aaactcgaagaagtttatgagaaaccatggagagaaaccatgggtcacgacataaacatg
agccttatcgtaaagaattgctttatcaatctaagcgacgaggaacttaattctcttgct
tattccctgaaaaatgtaaaattcgagagaatgagccttcttgacctgttacaggccctc
tttaaagccaataaaaaacttctctgggaccttcgagtactttttaaagatgccgcaaaa
gaagtggtgaaaaataagacgtaa

DBGET integrated database retrieval system