KEGG   Methanosarcina barkeri 227: MSBR2_2260Help
Entry
MSBR2_2260        CDS       T03914                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00564  Glycerophospholipid metabolism
mbar01100  Metabolic pathways
mbar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSBR2_2260
Enzymes [BR:mbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     MSBR2_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AKB58776
UniProt: A0A0E3LQS4
Position
complement(2958824..2959447)
Genome map
AA seq 207 aa AA seqDB search
MLAKGSEPWLFTAVSITALFAILSRAINSSHLNHVAYMAMALTFFMVLFFRDPERKVEVS
DTYMVSPADGTVIDIRDRKICIFMFLQNVHVNRAPISGKIREITYKKGGYLPAFCKDSER
NERNEFIIHSKYGDVSVMQIAGTIARRIVSYSRVDDNIEQGQRIGMIRLGSRVDVTIPNN
FEIIVRKGERVLAGKTIIATIKNDRDF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaaaaggttcggaaccctggctttttacagctgtgtctattactgcattgttt
gcaatactctccagagcaataaacagctctcatttaaaccacgttgcttacatggcaatg
gcactgactttctttatggttctttttttcagagaccccgaaagaaaggttgaagtttcg
gacacttatatggtttccccggccgatggcactgttatagacattcgagaccggaaaatc
tgtattttcatgtttctccagaatgtacatgtaaatagagctcctatttcgggaaagatc
agagaaataacttacaagaaaggtggatatcttcccgctttctgtaaagattctgaaaga
aacgaaagaaacgagtttattatccacagtaagtatggggatgttagtgtcatgcagatt
gcaggcacaattgccaggcgaatagtctcttattctcgagtagatgataacatcgagcag
ggacagcgcattgggatgattcgccttggatccagagttgacgtaacaatccccaataac
tttgagattatagtacggaaaggagagcgggtacttgcaggcaagaccattatagcaaca
ataaaaaatgacagggacttttga

DBGET integrated database retrieval system