KEGG   Methanosarcina barkeri 227: MSBR2_2283Help
Entry
MSBR2_2283        CDS       T03914                                 

Definition
(GenBank) Methyl coenzyme M reductase beta subunit
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00680  Methane metabolism
mbar01100  Metabolic pathways
mbar01120  Microbial metabolism in diverse environments
mbar01200  Carbon metabolism
Module
mbar_M00356  Methanogenesis, methanol => methane
mbar_M00357  Methanogenesis, acetate => methane
mbar_M00563  Methanogenesis, methylamine/dimethylamine/trimethylamine => methane
mbar_M00567  Methanogenesis, CO2 => methane
mbar_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbar00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSBR2_2283
Enzymes [BR:mbar01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     MSBR2_2283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N GSDH
Motif
Other DBs
NCBI-ProteinID: AKB58799
UniProt: A0A0E3R526
Structure
PDB: 

Position
complement(2983124..2984428)
Genome map
AA seq 434 aa AA seqDB search
MSDTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMG
GKGRQILGRGLNYDIVGNADAIAENVKKLVQVDEGDDTNVIKVKGGKSLLIQSPKSRIIA
GADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKAAVWGSYPQTMDLMGGQVQGILSIPQ
NNEGLGFSLRNIMANHVAAISNRNAMNASALSSIYEQSGIFEMGGAVGMFERHQLLGLAY
QGLNANNLLYDIVKENGKDGTIGTVIESVVRRAIEAGIISVDKTAPSGYNFYKANDVPKW
NACAAVGTLAATLVNCGAGRAAQNVSSTLLYFNDILEKETGLPGCDYGKVEGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGTQMFSIESTSGLIGDVFGAI
PEFREPIKAVAGVL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacacagtagacatctacgacgacagaggaaaactgctcgagagcaatgtcgac
attatgagccttgctccaacaagaaacgcagcaattcaatcgatcatcatggacactaag
aggtcagttgcagtcaacctcgcaggtattcagggtgcacttgccagtggcaagatgggc
ggaaagggccgtcagatcttaggccgcggacttaactatgacattgtaggcaatgctgat
gcaattgcagaaaatgttaaaaaactcgtccaggtcgatgaaggcgacgataccaatgtc
atcaaagtcaaaggcggaaagagcctcttgatccagtccccaaaatccaggattattgca
ggtgccgacttcatgtccgcaacaacagttggtgcagcagcagtcacccagactattatg
gacatgtttggaaccgatccttatgatgctcctatcgtaaaagcagctgtctggggaagc
tacccacagacaatggatctcatgggcggtcaggttcagggtattctcagcatccctcag
aacaatgaaggtcttggcttctccctcaggaacattatggccaaccacgttgcagcaatc
tccaacaggaatgcaatgaacgcatcagctctctcttccatctacgagcagtctggtatc
ttcgagatgggtggagcagtcggtatgttcgagaggcatcagctcctcggtcttgcatac
cagggtctcaacgccaacaatctcttatacgacattgttaaggaaaacggtaaggatgga
accattggaaccgttatcgaatccgttgtccgcagggcaattgaagctggtattatctcc
gttgacaagaccgctccctctggatacaacttctataaagcaaacgacgtccccaagtgg
aatgcctgtgcagcagtcggtacccttgcagccactctcgtgaactgtggtgcaggccgt
gcagctcagaacgtttcctcaacacttctctacttcaatgatatccttgagaaggaaact
ggtctcccaggatgtgactacggtaaagtagaaggtaccgcggtagggttctcattcttc
agccactccatctatggtggcggtgggcctggtgtcttcaacggtaaccacgtcgttacc
agacactccagaggattcgcaatcccctgtgtatgcgcagcagtcgctcttgatgcaggt
acccagatgttctcaatcgaatcaacatccggcctgataggtgacgtgtttggtgcaata
ccagaattccgcgagccgattaaggcagttgcaggagtgctctaa

DBGET integrated database retrieval system