KEGG   Methanosarcina barkeri 227: MSBR2_2400Help
Entry
MSBR2_2400        CDS       T03914                                 

Definition
(GenBank) Tetrahydromethanopterin S-methyltransferase subunit A 1
  KO
K00577  tetrahydromethanopterin S-methyltransferase subunit A [EC:2.1.1.86]
Organism
mbar  Methanosarcina barkeri 227
Pathway
mbar00680  Methane metabolism
mbar01100  Metabolic pathways
mbar01120  Microbial metabolism in diverse environments
mbar01200  Carbon metabolism
Module
mbar_M00357  Methanogenesis, acetate => methane
mbar_M00567  Methanogenesis, CO2 => methane
mbar_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbar00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSBR2_2400
Enzymes [BR:mbar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MSBR2_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrA
Motif
Other DBs
NCBI-ProteinID: AKB58916
UniProt: A0A0E3LQV2
Position
3148278..3148871
Genome map
AA seq 197 aa AA seqDB search
MKDIAEIWPIVKGDYTIGNPKSRIAVVTLASQINPSPEAALWGSSKTENLGVEKIIVNTI
SNSNIRYILICGTESRGHLAGHSLLAIHANGIDEKGRIIGSEGAIPFIENISKEAVKRFQ
QQVALLDRIGLTNLEEIMKIVRKYKDRGEVYPGEPLVAISQKKKQSTFTIPHSGDIIVSE
EFVMDSTAGVVCTTKEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacattgcagagatatggccgatagtaaaaggcgactacacgataggaaatccg
aagtctcggattgcagtggtaactcttgcgagccagataaatccctcgcctgaagcggcc
ctatgggggagctcaaaaaccgaaaatctgggagtcgaaaaaataatcgtaaataccatc
tcaaattccaacataaggtacatccttatctgcgggacggaatctaggggacacctggca
ggccattccctactcgcaatccatgcaaacgggattgacgaaaaaggaagaattattggt
tctgagggagctatccctttcatagaaaacatatctaaagaagcagtcaaacgctttcag
caacaggtagcgcttcttgacaggataggactgacaaacctcgaggaaataatgaaaatt
gtgagaaaatataaggatcgaggtgaagtttaccctggggaacctcttgtagctatttcc
cagaagaaaaaacaatctactttcacaattcctcattcaggtgatataatagtctccgaa
gaatttgtcatggactcaactgcaggagttgtctgcacgacaaaggagctttaa

DBGET integrated database retrieval system