KEGG   Labilibaculum antarcticum: ALGA_2995Help
Entry
ALGA_2995         CDS       T05376                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mbas  Labilibaculum antarcticum
Pathway
mbas00480  Glutathione metabolism
mbas00590  Arachidonic acid metabolism
mbas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ALGA_2995
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ALGA_2995
Enzymes [BR:mbas01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ALGA_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA Phosphonate-bd Adeno_E3_CR1
Motif
Other DBs
NCBI-ProteinID: BAX81300
UniProt: A0A1Y1CLX9
Position
complement(3877870..3878409)
Genome map
AA seq 179 aa AA seqDB search
MKRILTIVILIVASSLASYAQESIHQFTVTSIDGSEFNFADLKGKKVMVVNTASKCGLTP
QYELLEALYQEYQAENFVIVGFPANNFLWQEPGTDQEIKEFCTKNYGVSFPMMSKISVKG
DDIHPIYSWLTQKSENGVMDSKVKWNFQKYLIDEDGKLVDVLSPKEKPNCEKVILWLQQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatattaacaatagtaattttgattgtggcttccagtctggcaagttatgcc
caagaaagcattcatcaatttaccgttacttcaattgatggttccgaatttaattttgct
gatttgaagggcaaaaaagtcatggtcgttaatacagcatctaaatgcggattgactcct
cagtacgaattacttgaggctttataccaggaatatcaagctgaaaacttcgtgattgta
ggctttcctgccaacaactttctttggcaagaacctggaactgatcaggaaattaaagaa
ttttgcacgaagaattatggtgttagttttcccatgatgtcaaaaatatctgtaaaagga
gatgacattcaccctatttacagttggttgacacaaaaatcggaaaatggagttatggat
tccaaagtaaaatggaatttccaaaaatacctgattgatgaagatggaaagcttgttgat
gttctttctccaaaagagaaaccgaattgcgaaaaagtgatcttatggttgcaacagtaa

DBGET integrated database retrieval system