KEGG   Marinifilaceae bacterium SPP2: ALGA_3984Help
Entry
ALGA_3984         CDS       T05376                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
mbas  Marinifilaceae bacterium SPP2
Pathway
mbas00860  Porphyrin and chlorophyll metabolism
mbas01100  Metabolic pathways
Module
mbas_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mbas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ALGA_3984
Enzymes [BR:mbas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     ALGA_3984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAX82276
UniProt: A0A1Y1CPB8
Position
complement(5099166..5099702)
Genome map
AA seq 178 aa AA seqDB search
MEIYLIRHTKVNIEPGICYGQKDVDLALTYSEELEAVKEKLKDIDFDLIISSPLTRAKKL
ANDIFGDQVLEDKRLMELNFGDWEGKVWDEIKDPLFQAWMEDFVNKKCSNGESFVMLRDR
VLEFWNEIKSKDCKKIAIFTHGGVIRTIKAIEQNVKLEDSFNEPTTDFGEITILSTPK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatatttaatcagacacacaaaagtaaatattgaaccaggtatttgctatggc
caaaaagatgttgatttagctttaacttattctgaagaattggaagcagtaaaagaaaaa
ttaaaagatattgattttgacttgatcatttcaagtcccttaaccagagctaaaaagttg
gcaaatgatatttttggcgatcaggtattggaggacaagcgattaatggaattaaacttt
ggtgattgggaaggtaaagtttgggacgaaattaaagatccgttattccaggcctggatg
gaagattttgtaaataaaaaatgttccaatggagaatcatttgttatgcttcgcgatcgg
gttttagaattttggaacgaaataaaatcaaaagattgtaagaagattgcaattttcaca
catggaggtgtaattcgtacgattaaggcaattgagcaaaacgttaaactggaagactct
ttcaatgaaccgactactgattttggggagattaccattctatcaacgccaaagtaa

DBGET integrated database retrieval system