KEGG   Candidatus Methylopumilus planktonicus: BN1208_0733Help
Entry
BN1208_0733       CDS       T03869                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mbat  Candidatus Methylopumilus planktonicus
Pathway
mbat00670  One carbon pool by folate
mbat01100  Metabolic pathways
mbat01120  Microbial metabolism in diverse environments
mbat01200  Carbon metabolism
Module
mbat_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BN1208_0733 (fhs)
Enzymes [BR:mbat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BN1208_0733 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: CEZ19619
UniProt: A0A0D6EVZ3
Position
1:667030..668685
Genome map
AA seq 551 aa AA seqDB search
MKSDGEINQAAPLKSIDEIVKSLDIKIDDLNFYGPYQAKLKPSFINTLKEPKTAKLILVS
AMSPTPAGEGKTTTTIGLADALFLIGKKSVACLREPSLGPVFGMKGGATGGGYAQVAPMD
NINLHFTGDFHAITSANNLLAALIDNHIHHGNALNIDTNQISFKRCLDMNDRALRHVELK
LGQNHRDTGFDITSASEVMAILCLAESLEDLQYRLGEIEVAKRKDGVSVCAKDLKAEGAM
TALLKDAFQPNLVQTLHGTPAFIHGGPFANIAHGCNSVIATKTALKLADYVVTEAGFGAD
LGAEKFIDIKCRQSGIKPDIIVLVATIRALKFHGGISVPELNHENLKALELGFNNLKRHI
ENCSQHFGLDVVVSINKFNSDTEKEMTWLQSAIDKLGFKAILCSHWSDGAIGAKDLANAV
LEKLAKPKSCKFLYEDHLSLKEKITTIALKLYRSKEVEFSESALQKLLLLEKNYSSFPVC
IAKTPFSFSSDPKAHGAPENHTLMIRELRLSRGAGFVVAICGDLMTIPGLPKVPASENII
VNAQGLIEGLN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgatggagaaattaaccaagcagcaccattaaagtcgattgatgagatagtc
aagtcacttgatatcaaaatagacgacttaaatttttatggtccgtatcaagctaaatta
aagccttctttcatcaacaccttaaaagaacccaagacagctaaattaattctagtttct
gccatgagtcctactcctgcaggcgaaggaaaaacaaccaccacgattggtttggctgat
gcactttttttaattggtaaaaaatcagtcgcgtgtcttcgcgaaccttctttaggcccc
gtctttggaatgaaagggggtgcaacaggcggcggttatgcgcaagtggcacctatggat
aatattaatttacatttcacaggcgactttcatgctattacatctgctaataatctttta
gcagctttgattgacaatcatatacatcacggcaatgcactcaatattgataccaaccaa
atttcttttaagcgatgccttgatatgaatgaccgtgctttaagacatgtcgaattaaag
cttgggcaaaatcatcgagatacagggttcgatattacaagcgcaagtgaagtaatggcc
attctttgtttagcagagtcattagaagatcttcaatatcgactaggagagattgaagtt
gcaaaaagaaaagatggcgtatctgtttgtgcaaaggacttaaaagcagaaggcgcaatg
acagccttattgaaagatgcgtttcaacctaatctggttcaaacattgcatgggacacca
gcttttattcatggcggtccatttgctaatattgcgcatggatgtaactcagtcatcgcc
acaaaaacggcattgaaattagctgattatgtggtgacagaagcaggctttggtgcagac
ctaggcgctgaaaaattcattgatatcaaatgtagacagtcgggtatcaagcctgacatt
attgtcttagtcgcgaccattcgcgcactcaaatttcatggtggtatcagcgttcctgaa
ttaaatcatgaaaacttaaaagcactcgaacttgggtttaataacttaaagcgtcatatc
gaaaattgctcacaacattttggacttgatgtcgtagtttcaatcaataaatttaattct
gatacagaaaaagaaatgacatggcttcaaagcgcaatagataagttgggatttaaagca
atcctttgttcgcattggtcggatggcgctataggggctaaggatttagctaatgctgtt
ttagaaaaattagcaaaacctaaatcttgtaaatttttatatgaagatcatttaagttta
aaagaaaaaattactacaatcgctttaaaattatatcgttcaaaagaagttgagttttct
gaaagcgccttacaaaaactattattgcttgaaaaaaactattcaagctttcctgtctgt
attgcgaagacgcctttttcgttttcaagtgatcctaaagcacatggtgcccctgaaaat
catacactcatgataagagaattaaggctatcaagaggcgctggttttgtagtggcgatt
tgtggggatcttatgacgatcccaggccttcctaaagtccccgcaagtgaaaatataatt
gtaaatgcacaaggtcttatcgaaggattgaattga

DBGET integrated database retrieval system