KEGG   Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2: BCG_0183Help
Entry
BCG_0183          CDS       T00463                                 

Definition
(GenBank) Probable aldehyde dehydrogenase (nad+) dependant
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mbb  Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2
Pathway
mbb00010  Glycolysis / Gluconeogenesis
mbb00053  Ascorbate and aldarate metabolism
mbb00071  Fatty acid degradation
mbb00280  Valine, leucine and isoleucine degradation
mbb00310  Lysine degradation
mbb00330  Arginine and proline metabolism
mbb00340  Histidine metabolism
mbb00380  Tryptophan metabolism
mbb00410  beta-Alanine metabolism
mbb00561  Glycerolipid metabolism
mbb00620  Pyruvate metabolism
mbb00625  Chloroalkane and chloroalkene degradation
mbb00903  Limonene and pinene degradation
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCG_0183
   00053 Ascorbate and aldarate metabolism
    BCG_0183
   00620 Pyruvate metabolism
    BCG_0183
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCG_0183
   00561 Glycerolipid metabolism
    BCG_0183
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_0183
   00310 Lysine degradation
    BCG_0183
   00330 Arginine and proline metabolism
    BCG_0183
   00340 Histidine metabolism
    BCG_0183
   00380 Tryptophan metabolism
    BCG_0183
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCG_0183
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BCG_0183
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BCG_0183
Enzymes [BR:mbb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BCG_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAL70167
UniProt: A0A0H3M1F9
Position
203135..204655
Genome map
AA seq 506 aa AA seqDB search
MSDRVKAVAPPDGRTMMTTESVARKTQKSETEAPREPAPVSDEKQTDVAKTVARLRKTFA
SGRTRSVEWRKQQLRALQKLMDENEDAIAAALAEDLDRNPFEAYLADIATTSAEAKYAAK
RVRRWMRRRYLLLEVPQLPGRGWVEYEPYGTVLIIGAWNYPFYLTLGPAVGAIAAGNAVV
LKPSEIAAASAHLMTELVYRYLDTEAIAVVQGDGAVSQELIAQGFDRVMFTGGTEIGRKV
YEGAAPHLTPVTLELGGKSPVIVAADADVDVAAKRIAWIKLLNAGQTCVAPDYVLADATV
RDELVSKITAALTKFRSGAPQGMRIVNQRQFDRLSGYLAAAKTDAAADGGGVVVGGDCDA
SNLRIQPTVVVDPDPDGPLMSNEIFGPILPVVTVKSLDDAIRFVNSRPKPLSAYLFTKSR
AVRERVIREVPAGGMMVNHLAFQVSTAKLPFGGVGASGMGAYHGRWGFEEFSHRKSVLTK
PTRPDLSSFIYPPYTERAIKVARRLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgcgtcaaggcggtcgcgccgccggacggaaggacgatgatgaccaccgaa
tcggttgcccggaagacccagaaatctgagaccgaggctccgcgcgaaccggcgcccgtt
tcggatgaaaagcaaaccgatgtcgctaaaacggtggctcggctgcgaaagacctttgcc
agcgggcgtacccgcagcgtcgagtggcgcaagcagcagttgcgcgcgctacagaagttg
atggacgagaacgaggacgcgatcgccgcggcactcgccgaggatctggatcgcaatccg
ttcgaggcatacctcgctgacatcgcgacgacctccgccgaagcgaaatacgcggccaag
cgggtgcgcaggtggatgcggcgccgctacctgctgctcgaggtgccgcagctgcccggc
cgcggctgggtggagtacgagccatatggcaccgtgctaatcatcggtgcctggaactac
ccgttctacctgaccctgggtccggcggtcggagccattgccgctggaaacgccgtcgtg
ctcaaaccgtcggaaatcgccgctgcatcggcgcacttgatgaccgaattggtgtatcgc
tatctcgacaccgaagcgatcgcggtcgtgcagggcgatggtgcggtgagtcaggagctg
atcgctcagggtttcgaccgcgtgatgttcaccggtggcaccgagatcggccgcaaggtc
tacgaaggcgccgcgccgcacctgaccccggtcaccctcgagctcggcggcaagagcccg
gtgatcgtcgcggccgatgccgatgtagatgtcgcggccaagcggatcgcctggatcaaa
ctgctcaacgccgggcagacatgcgttgcacccgactatgtgctggcggatgccaccgtc
cgcgacgagctggtcagcaagatcaccgcggccctcaccaagttccgctccggtgcgccg
cagggcatgcgcatcgtcaaccagcgtcaattcgaccggctgagtggatacctcgccgca
gcgaaaaccgacgctgcagccgacggcggcggggtcgtcgtgggcggcgactgtgacgca
tcgaacctgcgcatccaacccaccgtggtcgtcgatcccgacccggacgggccgttgatg
agcaacgagatcttcggaccgatcctgccggtggtcaccgtcaaatctctggacgacgcg
attcgcttcgtgaactcgcggcccaagccgctatcggcgtacctgttcactaagtcgcgt
gcggttcgcgagcgggtgatcagggaggtgccggcgggcggaatgatggttaaccatttg
gcttttcaggtgtcgacggccaaactgccgttcggtggtgtcggcgcatcgggcatgggt
gcctaccacggccgttggggtttcgaggagttcagccaccgtaagtcggtgttgaccaaa
ccaacccgacccgacctgtccagctttatctacccgccgtacaccgagcgcgccatcaag
gtggctcgccggctgttctga

DBGET integrated database retrieval system