KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_0675cHelp
Entry
BCG_0675c         CDS       T00463                                 

Gene name
recD
Definition
(GenBank) Probable exonuclease V (alpha chain) recD
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mbb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BCG_0675c (recD)
Enzymes [BR:mbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCG_0675c (recD)
DNA repair and recombination proteins [BR:mbb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BCG_0675c (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD AAA_22 Viral_helicase1 UvrD-helicase AAA_16 AAA_25 Herpes_Helicase AAA_29 AAA_28 Mg_chelatase T2SSE NTPase_1 DEAD TrwB_AAD_bind ATPase AAA_5 AAA_23 SRP54 MukB DUF2075 cobW PhoH
Motif
Other DBs
NCBI-ProteinID: CAL70661
UniProt: A0A0H3M8I8
Position
complement(750891..752618)
Genome map
AA seq 575 aa AA seqDB search
MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA
GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE
EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTV
ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT
LHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSG
EERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVL
HWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISG
ASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVARAKR
KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaccgacgtcgattttgccgtcgaggcctccgggatggtgcgggccttcaac
caggccggtgtgctggacgtgtcggatgtgcatgtggcgcaacgtctctgtgcactggcc
ggggagagcgacgagcgggtggcgttggcggtagcggtggcggtccgcgcgctacgggcc
ggttcggtgtgtgtggatctgttgtcgatcgcgcgggttgctggacacgacgacctgccg
tggccggatccggcggactggttggcggcggtgcgggccagtccgttgctcgccgatcca
cccgtgctgcacctgtatgacgatcggctgctctatctggaccgctactggcgcgaagaa
gagcaggtgtgcgcggacctgctcgcgttgctgacatccaggcgaccggccggggtaccc
gacttgcggcgactgttcccgaccggctttgacgagcagcggcgcgcggcggaaatcgcg
ctctcgcaaggtgttacggtgttgactggcgggcctggcaccggaaagacgacgacggtc
gcgcggctgctggcgttggttgccgagcaggcggagctggccggtgagccgcggccgcgg
atcgcgctggccgcacccaccggcaaggcggcggcccggctggccgaggcggtacggcgc
gagatggccaagctcgacgccaccgaccgggcacggctcggcgacctgcacgcggtcacg
ctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgccaggatcgccagaaccgg
ttgcctcacaacgtgatcgtggtcgacgagacctcgatggtgtcgctgacgctgatggcc
cggctggccgaggcggtgcgcccgggcgcccggttgatcctcgtcggcgatgccgaccag
ttggcgtcggtggaagccggagcggtgctggcggatttggtcgatggcttctcggtacgc
gacgacgcgctggtggcgcagctgcgaacgtcgcatcggttcggcaaggtgatcggtacc
ttggccgaagcgatccgggccggcgatggcgatgccgtactgggcctgctgcgctcgggt
gaggagcggatcgagttcgtcgacgacgaggatccggcgccgcggttgcgcgcggtgctg
gtgccacacgcgttgcggctgcgcgaggcggcgctgttgggtgcctccgacgtcgcgttg
gccaccctggacgagcaccggctgctgtgtgcgcatcgggacgggcccaccggcgtgctg
cactggaaccgccgggttcaagcctggctcgccgaggagaccggccagccgccctggacg
ccgtggtacgccgggcgtccgctgctggtgacggccaacgactacggccttcgcgtctac
aacggcgacaccggtgtcgtgctggccggccccaccggtctgcgggccgtcatttctggt
gcatccgggccacttgacgttgccaccggccgcctcggcgacgtcgagaccatgcacgcg
atgaccatccacaagagtcagggcagccaggtcgacgaggtgacggtgctgatgccgcaa
gaggattcgcggttgctgacccgggagttgctgtacaccgcggtggcccgggccaaacgc
aaggtccgggtggtcgggtccgaagcttcggtgcgggccgcgatcgcacgccgggcggtg
cgggccagcgggttgcggatgcggttacagtcgacggggtgtggctga

DBGET integrated database retrieval system