KEGG   Mycobacterium bovis BCG Pasteur 1173P2: BCG_1132cHelp
Entry
BCG_1132c         CDS       T00463                                 

Gene name
fadA3
Definition
(GenBank) Probable beta-ketoacyl CoA thiolase fadA3
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbb  Mycobacterium bovis BCG Pasteur 1173P2
Pathway
mbb00071  Fatty acid degradation
mbb00072  Synthesis and degradation of ketone bodies
mbb00280  Valine, leucine and isoleucine degradation
mbb00310  Lysine degradation
mbb00362  Benzoate degradation
mbb00380  Tryptophan metabolism
mbb00620  Pyruvate metabolism
mbb00630  Glyoxylate and dicarboxylate metabolism
mbb00640  Propanoate metabolism
mbb00650  Butanoate metabolism
mbb00900  Terpenoid backbone biosynthesis
mbb01100  Metabolic pathways
mbb01110  Biosynthesis of secondary metabolites
mbb01120  Microbial metabolism in diverse environments
mbb01130  Biosynthesis of antibiotics
mbb01200  Carbon metabolism
mbb01212  Fatty acid metabolism
mbb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCG_1132c (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    BCG_1132c (fadA3)
   00640 Propanoate metabolism
    BCG_1132c (fadA3)
   00650 Butanoate metabolism
    BCG_1132c (fadA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCG_1132c (fadA3)
   00072 Synthesis and degradation of ketone bodies
    BCG_1132c (fadA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCG_1132c (fadA3)
   00310 Lysine degradation
    BCG_1132c (fadA3)
   00380 Tryptophan metabolism
    BCG_1132c (fadA3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCG_1132c (fadA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCG_1132c (fadA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCG_1132c (fadA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbb04147]
    BCG_1132c (fadA3)
Enzymes [BR:mbb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCG_1132c (fadA3)
Exosome [BR:mbb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCG_1132c (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAL71119
UniProt: A0A0H3MC12
Position
complement(1229455..1230672)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAMKGSLVGMRPDDLAVQMVRAALDKVPALNPHQIDDLMMGCGLP
GGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SRFAKGNSDSWPDTKNPLFDGAQERSAAAAAGADEWHDPRTDQKLPDIYIAMGQTAENVA
IMTGISREEQDRWGVRSQNRAEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKV
SELKPAFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEASKKALERAGMAITDIDLVEINEAFAVQVLGSARELGIDEDKLNISGGAIALGH
PFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctgtcatcgtctcgactgcccgctcgccgattggccgggccatgaaagga
tcgctggtcggcatgcggcccgacgacctggccgtccagatggtgcgcgccgcgctcgac
aaggttccggcactgaacccccatcagatcgacgacctcatgatgggctgtggcctgcca
ggcggtgagtccggtttcaacatcgcccgtgtcgtcgccgtcgcgctcggctatgacttc
ctgccgggcaccacggtcaaccggtactgttcgtcgtcgctgcagaccacccggatggcc
ttccacgcgatcaaggccggtgagggcgacgcgttcatctccgcgggcgtggaaaccgtc
tcccggttcgccaagggaaactccgactcctggccggacaccaagaacccgctgttcgac
ggggctcaggaacgttcggccgcggcagccgccggcgccgacgaatggcacgatccccgc
accgatcagaagctgccggacatctatattgcgatgggccagaccgcggaaaacgtcgcc
atcatgaccggcatcagccgcgaagaacaggaccgctggggcgtgcgcagccagaaccgg
gccgaagaggcgatcaagaacgggttcttcgaacgagaaatcacgccggtcacccttccg
gacggcaccacggtcagcaccgacgacggcccgcgaccgggtaccacctacgaaaaggtc
agcgagctcaagccggctttccggccgaatggcaccgtgaccgcggggaatgcctgtccg
ctcaacgacggggccgccgcggtggtgatcaccagcgacaccaaggccaaggaattaggc
ttgacaccgctggcgcgcattgtgtccaccggggtcagcgggctgtccccggagatcatg
ggcttagggccgatcgaggcgtccaagaaggcgctggaaagagccgggatggcgatcacc
gacatcgacctggtcgagatcaacgaggccttcgcggtgcaggtcctgggctcggcgcgc
gagctgggcatcgacgaggacaagctcaacatctcaggtggcgcgatcgccctaggtcac
ccgttcggtatgacgggtgcgcgcatcaccaccacgctgttgaacaacctgcagacctac
gacaagacgttcggtctggaaaccatgtgtgtcggtggcggccagggcatggcgatggtg
atcgagcgcctcgcgtga

DBGET integrated database retrieval system