KEGG   Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2: BCG_1167cHelp
Entry
BCG_1167c         CDS       T00463                                 

Gene name
xseB
Definition
(GenBank) Probable exodeoxyribonuclease VII (small subunit) xseB
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
mbb  Mycobacterium tuberculosis variant bovis BCG Pasteur 1173P2
Pathway
mbb03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mbb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BCG_1167c (xseB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mbb03400]
    BCG_1167c (xseB)
Enzymes [BR:mbb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     BCG_1167c (xseB)
DNA repair and recombination proteins [BR:mbb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     BCG_1167c (xseB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S
Motif
Other DBs
NCBI-ProteinID: CAL71154
UniProt: A1KHP7
Position
complement(1265381..1265638)
Genome map
AA seq 85 aa AA seqDB search
MVCDPNGDDTGRTHATVPVSQLGYEACRDELMEVVRLLEQGGLDLDASLRLWERGEQLAK
RCEEHLAGARQRVSDVLAGDEAQNG
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggtctgtgaccccaacggcgatgacacgggcagaacccacgcaactgtgcctgtcagt
cagcttggctatgaagcctgccgggacgagctgatggaagtcgtgcggcttctggagcag
ggcggattggacctcgatgcgtcgctgcgactgtgggaaagaggggagcaactcgccaaa
aggtgcgaggagcacttagctggtgcacgccagcgggtgtccgatgtgctggccggcgac
gaggcccaaaacggctaa

DBGET integrated database retrieval system